Gene 89075.m00073 (T.vaginalis)
89075.m00073
Species: T.vaginalis
Alias: TvagK0870, 89075.m00073
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| 89075.m00073.AA | Protein | None | 836 | None | Fasta, JSON |
| 89075.m00073.kin_dom | Protein Kinase Domain | None | 248 | None | Fasta, JSON |
Protein domains of 89075.m00073.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | 89075.m00073.AA | Fer | 217-260 | 22 | 2.7e-08 | 24.48 | In-house | 239-283 (283) | Show / Hide |
Range on Protein: 217-260 Range on HMM: 239-283/283 Sequence Identity: 22% (10 aa) KLLNGFRPIFDVRAPLFIQSIME-SCWTQEPQRRPSANQVQRLFL . .| .. . ..| .| .||. .||...| ||....... . IIKKGYMMPMPNHMPPEIMQIMMKQCWQKDPEDRPTMKEICQKLK |
|||||||||
| Kinase | 89075.m00073.AA | TK | 230-259 | 26 | 8.9e-08 | 21.34 | In-house | 457-486 (486) | Show / Hide |
Range on Protein: 230-259 Range on HMM: 457-486/486 Sequence Identity: 26% (8 aa) APLFIQSIMESCWTQEPQRRPSANQVQRLF .| ... .| .|| .|..||. |... . PPEEYYDLMQQCWHYDPEDRPTFSQLHEQL |
|||||||||
| Kinase | 89075.m00073.AA | TKL | 171-259 | 15 | 2.9e-07 | 22.24 | In-house | 239-364 (364) | Show / Hide |
Range on Protein: 171-259 Range on HMM: 239-364/364 Sequence Identity: 15% (19 aa) FVAPEL------QTIYA----------PNFMTDMFSLSMVICRFFSQGYKFKPSHKSGSI---------GFKLLNGFRPIFD------------VRAPLF . |||. | .. . .|..| .|.. .. .. . . | ..| || . .| WMAPEVLRGQMNYTEKVGIDEFCKGFEYSEKCDVYSFGIVLWEILTRCRPYYDYPYMPMIFQDPFEEMFMMVCDKGLRPPIPPIWQNHHKMCPCPDCPPS IQSIMESCWTQEPQRRPSANQVQRLF . ..|. || ..|. |||.... . MKKLMQDCWDHDPEKRPSFQEILKRL |
|||||||||
| Kinase | 89075.m00073.AA | PDGFR | 230-259 | 36 | 6.5e-07 | 17.83 | In-house | 329-358 (358) | Show / Hide |
Range on Protein: 230-259 Range on HMM: 329-358/358 Sequence Identity: 36% (11 aa) APLFIQSIMESCWTQEPQRRPSANQVQRLF || | .|| .|| .|..||. |. . APEEIYEIMQKCWDFDPEKRPTFQQLCQFL |
|||||||||
| Kinase | 89075.m00073.AA | RTKB | 230-259 | 33 | 7.3e-07 | 19.19 | In-house | 235-264 (264) | Show / Hide |
Range on Protein: 230-259 Range on HMM: 235-264/264 Sequence Identity: 33% (10 aa) APLFIQSIMESCWTQEPQRRPSANQVQRLF .| . || || |.| ||. . ..| MPQAADHIMQMCWQMEAQHRPDFDELVDAF |
|||||||||
| S_TKc | 89075.m00073.AA | S_TKc | 5-260 | 13 | 2e-06 | -82.65 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 5-260
Range on HMM: 1-231/231
Sequence Identity: 13% (38 aa)
YSNVKPICEHANTKVFIATNNLDQQLEIITQISNLNLSEIDIKSFKANFNILSKLSHPAISIPYKFKILQNSLSTIFLFAKTNT-TKTMDDYLVNVTQNE
| ...| . | ||. .... .... | .|. .... .||.| || | . .. . . . . .. . .. ||... .
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK---------EHIRREIQILKK-HHPNI-VKLYDVFQD--DHLYMVMEYCDGDLGDLFDYIKKRGRHG
----YNPEMSILFSAGVISAITYLHSNNIVCNDITFDSILIDENLFPI------FSSIGTYFLLPSLGPPSDLHDSV----FVAPELQTIYAPNF-MTDM
... . . . ...|. |.||..|. |. . ||.|| | .. . . . ..|||. .. |.
LRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE---HIKICDFGLARQL--------------TTFCGTPWYMAPEVL---GYGKCKCDW
FSLSMVICRFFSQGYKFKPSHKSGSIGFKLLNGFRPIFDVRAPLFIQSIMESCWTQEPQRRPSANQVQR--------LFL
|. .. ... | ..... . | ... ... |.. .|..||.| .. . ..
WSCGCILYEMLCGYPPFP-------QMQMMFKKIG------SPEAKD-FIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | 89075.m00073.AA | Pkinase_Tyr | 230-259 | 26 | 3e-06 | 21.69 | Pfam | 241-270 (270) | Show / Hide |
Range on Protein: 230-259 Range on HMM: 241-270/270 Sequence Identity: 26% (8 aa) APLFIQSIMESCWTQEPQRRPSANQVQRLF .| | ..| .|| ..|..||. .... . CPDEIYDLMKQCWHYDPEDRPTFSEIHEQL |
|||||||||
| Kinase | 89075.m00073.AA | RGC | 222-261 | 20 | 5e-06 | 17.38 | In-house | 253-300 (300) | Show / Hide |
Range on Protein: 222-261 Range on HMM: 253-300/300 Sequence Identity: 20% (10 aa) FRPIFDVR-------APLFIQSIMESCWTQEPQRRPS-ANQVQRLFLS ||| . .. . ..|. ||. | ||. ..|.. .. . FRPSIHEDEEGHMIECNPCLLHLMRDCWAEDPEERPDMFDQIRKQLKT |
|||||||||
| Kinase | 89075.m00073.AA | RGC | 222-261 | 20 | 6e-06 | 17.38 | In-house | 253-300 (300) | Show / Hide |
Range on Protein: 222-261 Range on HMM: 253-300/300 Sequence Identity: 20% (10 aa) FRPIFDVR-------APLFIQSIMESCWTQEPQRRPS-ANQVQRLFLS ||| . .. . ..|. ||. | ||. ..|.. .. . FRPSIHEDEEGHMIECNPCLLHLMRDCWAEDPEERPDMFDQIRKQLKT |
|||||||||
| Kinase | 89075.m00073.AA | LRRK | 235-261 | 25 | 9e-06 | 16.33 | In-house | 325-351 (351) | Show / Hide |
Range on Protein: 235-261 Range on HMM: 325-351/351 Sequence Identity: 25% (7 aa) QSIMESCWTQEPQRRPSANQVQRLFLS |. ...||...|..||...|. . QDLIQHCWQHDPKKRPHFSQIVKRLSQ |
|||||||||
| Kinase | 89075.m00073.AA | KIN6 | 237-259 | 43 | 1.3e-05 | 14.32 | In-house | 283-305 (305) | Show / Hide |
Range on Protein: 237-259 Range on HMM: 283-305/305 Sequence Identity: 43% (10 aa) IMESCWTQEPQRRPSANQVQRLF || ||| | .|| |.. .| IMQSCWQEKPDDRPEFNEMRMQF |
|||||||||
| Kinase | 89075.m00073.AA | TKL-Sp1 | 234-259 | 42 | 3e-05 | 11.9 | In-house | 238-263 (263) | Show / Hide |
Range on Protein: 234-259 Range on HMM: 238-263/263 Sequence Identity: 42% (11 aa) IQSIMESCWTQEPQRRPSANQVQRLF .| |.| | |.| .|||| . | VQKILEPCFDQKPEKRPSAEDLLDQF |
|||||||||
| Kinase | 89075.m00073.AA | TKL | 115-144 | 31 | 0.01889 | 4.65 | In-house | 140-177 (364) | Show / Hide |
Range on Protein: 115-144 Range on HMM: 140-177/364 Sequence Identity: 31% (12 aa) GVISAITYLHSNN--------IVCNDITFDSILIDENL .. ... ||||.| |. |.. . ||.|||. DIARGMNYLHSMNPKWCTKPPIIHRDLKSKNILVDENW |
|||||||||
| Kinase | 89075.m00073.AA | TKL-Sp1 | 113-133 | 42 | 0.067108 | 1.24 | In-house | 104-124 (263) | Show / Hide |
Range on Protein: 113-133 Range on HMM: 104-124/263 Sequence Identity: 42% (9 aa) SAGVISAITYLHSNNIVCNDI | .| .|.|..| || || SCEVLQAVTFMHACNILHLDI |
|||||||||
| Ank | 89075.m00073.AA | Ank | 745-778 | 41 | 3.6e-07 | 30.1 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 745-778 Range on HMM: 1-33/33 Sequence Identity: 41% (14 aa) DGKTPLMAAAESGNLELIKLLLKTKAIDQNLQME || |||. |...|..| .|.||. . | |.| DGFTPLHLACRCGHTEVVKMLLQ-HGADVNAQDD |
|||||||||
| Ank | 89075.m00073.AA | Ank | 677-710 | 38 | 6.3e-05 | 22.03 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 677-710 Range on HMM: 1-33/33 Sequence Identity: 38% (13 aa) FGRTALHAAAFNGAVESLSILLSMSEIDVNRKDN |.|.|| |...| .| .. ||. ||| .|. DGFTPLHLACRCGHTEVVKMLLQ-HGADVNAQDD |
|||||||||
| Ank | 89075.m00073.AA | Ank | 711-744 | 41 | 0.000458 | 18.92 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 711-744 Range on HMM: 1-33/33 Sequence Identity: 41% (14 aa) FGETPFYLACERGNFFSVKQFLSDKRVDVNAANE |.|| |||..|. || .|. . |||| . DGFTPLHLACRCGHTEVVKMLLQ-HGADVNAQDD |
|||||||||
| Ank | 89075.m00073.AA | Ank | 779-791 | 30 | 1.915457 | 5.86 | Pfam | 1-13 (33) | Show / Hide |
Range on Protein: 779-791 Range on HMM: 1-13/33 Sequence Identity: 30% (4 aa) NGQTAFHCAASYD .|.|. |.|.... DGFTPLHLACRCG |
|||||||||
| Ank | 89075.m00073.AA | Ank | 812-831 | 25 | 27.067966 | 1.71 | Pfam | 1-19 (33) | Show / Hide |
Range on Protein: 812-831 Range on HMM: 1-19/33 Sequence Identity: 25% (5 aa) KGRTAIDIAIKNGFDSSVIE |.|. .|...| . .|.. DGFTPLHLACRCG-HTEVVK |
|||||||||