Gene 32892 (M.brevicollis)

32892

Species: M.brevicollis
Alias: 32892
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: BSD-SH2

Sequence

Name Sequence Type Origin Length Description Download
32892.AA Protein None 592 None Fasta, JSON

Protein domain

Protein domains of 32892.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
BSD 32892.AA BSD 119-180 35 3.3e-15 54.43 Pfam 1-64 (64) Show / Hide 
Range on Protein: 119-180
Range on HMM: 1-64/64
Sequence Identity: 35% (23 aa)

PGAQDFDF-VFERAFPKALAILEHDARLQAMRFELV-PKKLSEQHFWRNYFYRVSLIKQSYGLA
.   |..|  ..  .  . .||. |  |..|..||| |||.||. ||..|||.|  .|| .   
WENWDNEFSDWDEQTEHIQKILQEDPELRKMYNELVIPKKMSEEEFWKRYFYSVHFHKQREEQR
BSD 32892.AA BSD 122-174 33 1.5e-13 52.3 SMART 1-56 (56) Show / Hide 
Range on Protein: 122-174
Range on HMM: 1-56/56
Sequence Identity: 33% (19 aa)

QDFDFVFERAFPKAL--AILEHDARLQAMRFE-LVPKKLSEQHFWRNYFYRVSLIK
... | |.     ..  |||...  |.....| ||||..|| .||..|||.....|
WENEFMFDWQYEHIEFQAILKENPDLKKLYNEYLVPKYMSEDEFWKRYFYLHHCHK
SH2 32892.AA SH2 433-510 40 7.7e-30 89.43 Pfam 1-81 (81) Show / Hide 
Range on Protein: 433-510
Range on HMM: 1-81/81
Sequence Identity: 40% (33 aa)

YYHGTISREEAVRRLQE-VNTDGAFLLRLSATQKDAYTISLQSNG---EIKHIRVTNTSNGGYALGKSKEEFESIWDLIEAQ
.||| |||.|| |.|..  |.||.||.| | ...  ||.|.  .|   ..||.|. .| |||| ..  .  |.|...|.|  
WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHK-FCSLQELVEHY
SH2 32892.AA SH2 431-516 31 7.5e-25 89.8 SMART 1-87 (87) Show / Hide 
Range on Protein: 431-516
Range on HMM: 1-87/87
Sequence Identity: 31% (28 aa)

RSYYHGTISREEAVRRLQEV-NTDGAFLLRLSATQKDAYTISLQSNGEIKHIRVTNTSNGGYALGK-SKEEFESIWDLIEAQLDKSLK
  .||| ||||||.. |. . . ||.||.| | ... .|..|. ..|..||.|.  . .|.| ..  ... |.|. .|..     .| 
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDETWRRKFPSL-ELVNHYQHNPLG