Gene 8798 (M.brevicollis)
8798
Species: M.brevicollis
Alias: 8798
External Links:
Annotation:
Sequence
Protein domains of 8798.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| SH2 | 8798.AA | SH2 | 149-187 | 32 | 1.5e-12 | 38.71 | Pfam | 1-43 (81) | Show / Hide |
Range on Protein: 149-187 Range on HMM: 1-43/81 Sequence Identity: 32% (14 aa) WYYRNVTRQDVEVMLQD---PAGNFVVRPAR-QAGQFVLSFKF ||.....||..| .|. | | |.||. . . |...||... WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRD |
|||||||||
| SH2 | 8798.AA | SH2 | 147-208 | 18 | 0.000712 | 6.95 | SMART | 1-87 (87) | Show / Hide |
Range on Protein: 147-208 Range on HMM: 1-87/87 Sequence Identity: 18% (16 aa) EDWYYRNVTRQDVEVMLQDP---AGNFVVRPARQ-AGQFVLSFKF--------VAQSASPLFVAWS-------------SYVWLIIP . ||. |..|...| .|. | | |.||. .. .|..|||... . .... .. . | .. QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDETWRRKFPSLELVNHYQHNPLG |
|||||||||