Gene n1176 (Tetrahymena)

n1176

Species: Tetrahymena
Alias: 1176, n1176, 587.m00002
External Links:
Annotation:

Classification

Group: Other
Family: Ciliate-C5

Sequence

Name Sequence Type Origin Length Description Download
n1176.AA Protein None 346 None Fasta, JSON
n1176.NA RNA None 1041 None Fasta, JSON

Protein domain

Protein domains of n1176.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase n1176.AA Ciliate-C5 52-67 93 4.9e-09 25.62 In-house 1-16 (260) Show / Hide 
Range on Protein: 52-67
Range on HMM: 1-16/260
Sequence Identity: 93% (15 aa)

IYLTSYISQGSFGCVF
||||||||||.|||||
IYLTSYISQGGFGCVF
Kinase n1176.AA Ciliate-C5 70-158 82 5.2e-53 172.73 In-house 172-260 (260) Show / Hide 
Range on Protein: 70-158
Range on HMM: 172-260/260
Sequence Identity: 82% (73 aa)

NGSFNIKYDIYGLGVILLELTLGKFLEYEDCKSIRNGELAKYISKNVLYQDINYIIVKMLDQISQNRIDSFELTKQLNELRLKLENQFI
||.|||||||||||.|||||||||||| |||  ||||.| .||||| |||||| ||.|||... |||||||||||||||||||||.|||
NGFFNIKYDIYGLGIILLELTLGKFLEDEDCTFIRNGKLPNYISKNALYQDINQIIIKMLEKMPQNRIDSFELTKQLNELRLKLESQFI
Kinase n1176.AA Ciliate-E5 78-90 69 0.000159 10.41 In-house 259-271 (271) Show / Hide 
Range on Protein: 78-90
Range on HMM: 259-271/271
Sequence Identity: 69% (9 aa)

DIYGLGVILLELT
||| ||.. ||||
DIYSLGIVFLELT