CC1G_10350

Species: C.cinerea
Alias: CC1G_10350
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_10350.AA Protein None 726 None Fasta, JSON
CC1G_10350.NA RNA None 2181 None Fasta, JSON
CC1G_10350.kin_dom Protein Kinase Domain None 348 None Fasta, JSON

Protein domain

Protein domains of CC1G_10350.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_10350.AA Ciliate-E2 439-468 41 5.2e-05 13.11 In-house 178-197 (365) Show / Hide
Range on Protein: 439-468
Range on HMM: 178-197/365
Sequence Identity: 41% (13 aa)

KKN-IIHRDISPRNIVFGTEDAEPGWEGVVI
.|| |||||| | ||.|           . |
SKNNIIHRDIKPENILF-----------IKI

Kinase CC1G_10350.AA Ciliate-E2-Unclassified 437-454 63 0.000147 11.76 In-house 159-177 (352) Show / Hide
Range on Protein: 437-454
Range on HMM: 159-177/352
Sequence Identity: 63% (12 aa)

YIKKN-IIHRDISPRNIVF
...|| |||||| | ||.|
LHHKNNIIHRDIKPENILF

Kinase CC1G_10350.AA Ciliate-A1 439-458 45 0.00024 10.63 In-house 119-138 (301) Show / Hide
Range on Protein: 439-458
Range on HMM: 119-138/301
Sequence Identity: 45% (9 aa)

KKNIIHRDISPRNIVFGTED
..||.|||. | ||. . .|
DHNILHRDLKPQNILIHFDD