Gene CC1G_02150 (C.cinerea)
CC1G_02150
Species: C.cinerea
Alias: CC1G_02150
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CC1G_02150.AA | Protein | None | 807 | None | Fasta, JSON |
| CC1G_02150.NA | RNA | None | 2424 | None | Fasta, JSON |
| CC1G_02150.kin_dom | Protein Kinase Domain | None | 264 | None | Fasta, JSON |
Protein domains of CC1G_02150.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | CC1G_02150.AA | TKL-Unique | 605-630 | 50 | 5.2e-07 | 20.96 | In-house | 135-160 (290) | Show / Hide |
Range on Protein: 605-630 Range on HMM: 135-160/290 Sequence Identity: 50% (13 aa) HRDLSPSNILADRNSPSGPWQVKLSD |||| .||.| |.||.. .|..|..| HRDLKSSNFLVDNNSNIAEWNIKICD |
|||||||||
| Kinase | CC1G_02150.AA | TTBKL | 591-613 | 43 | 0.0001 | 11.97 | In-house | 111-133 (288) | Show / Hide |
Range on Protein: 591-613 Range on HMM: 111-133/288 Sequence Identity: 43% (10 aa) CVLALRLMFCAGWVHRDLSPSNI |. ||..| .|..|||. |.|. CLYALKQMHDCGFIHRDVKPCNC |
|||||||||
| Kinase | CC1G_02150.AA | IRE | 604-631 | 38 | 0.000152 | 11.2 | In-house | 138-168 (292) | Show / Hide |
Range on Protein: 604-631 Range on HMM: 138-168/292 Sequence Identity: 38% (12 aa) VHRDLSPSNILADR--NSPSG-PWQVKLSDL ||||| | ||| . .. .| ...||. VHRDLKPHNILIHMNRPNQHGENNRFMISDF |
|||||||||
| Kinase | CC1G_02150.AA | CRIK | 602-617 | 68 | 0.000368 | 8.77 | In-house | 120-135 (272) | Show / Hide |
Range on Protein: 602-617 Range on HMM: 120-135/272 Sequence Identity: 68% (11 aa) GWVHRDLSPSNILADR | |||| | ||| || GYVHRDIKPENILIDR |
|||||||||
| Kinase | CC1G_02150.AA | GSK | 604-630 | 37 | 0.00068 | 7.12 | In-house | 138-160 (328) | Show / Hide |
Range on Protein: 604-630 Range on HMM: 138-160/328 Sequence Identity: 37% (10 aa) VHRDLSPSNILADRNSPSGPWQVKLSD .|||. |.||| |. . ...|..| CHRDIKPQNILVDPDT----GVLKICD |
|||||||||
| Kinase | CC1G_02150.AA | TKL | 604-631 | 35 | 0.000886 | 9.5 | In-house | 162-198 (364) | Show / Hide |
Range on Protein: 604-631 Range on HMM: 162-198/364 Sequence Identity: 35% (13 aa) VHRDLSPSNILADRN---------SPSGPWQVKLSDL .|||| ..||| |.| .| .| .|..|. IHRDLKSKNILVDENWTNVSNYMYNPNADWCCKICDF |
|||||||||