CC1G_07432

Species: C.cinerea
Alias: CC1G_07432
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07432.AA Protein None 764 None Fasta, JSON
CC1G_07432.NA RNA None 2295 None Fasta, JSON
CC1G_07432.kin_dom Protein Kinase Domain None 431 None Fasta, JSON

Protein domain

Protein domains of CC1G_07432.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07432.AA TKL-Unique 437-468 34 6.8e-05 13.39 In-house 134-165 (290) Show / Hide
Range on Protein: 437-468
Range on HMM: 134-165/290
Sequence Identity: 34% (11 aa)

LHGDLSPGNILAFRSSPDTPWQVKLSDLEFSK
.|.|| . |.|  . |.  .|..|..| ..||
IHRDLKSSNFLVDNNSNIAEWNIKICDFGLSK