Gene CC1G_09358 (C.cinerea)

CC1G_09358

Species: C.cinerea
Alias: CC1G_09358
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_09358.AA Protein None 418 None Fasta, JSON
CC1G_09358.NA RNA None 1257 None Fasta, JSON
CC1G_09358.kin_dom Protein Kinase Domain None 246 None Fasta, JSON

Protein domain

Protein domains of CC1G_09358.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_09358.AA TAO 7-80 37 0.000327 9.34 In-house 104-166 (254) Show / Hide 
Range on Protein: 7-80
Range on HMM: 104-166/254
Sequence Identity: 37% (28 aa)

ILKQCLSVLRLVFCAGWVHRDLSAGNILALRDGPNKKWQVKLSDLEYAKRFPSDDHCASPVPKTGTPYFMAIEI
| .. |. || .     .|||. |||||   .|     ||||.|   |      .   | |   ||||.|| |.
ICHGALQGLRYLHSHKMIHRDIKAGNILLTEHG-----QVKLADFGSASMV---CPANSFV---GTPYWMAPEV
Kinase CC1G_09358.AA RTKF 22-50 48 0.000481 8.63 In-house 126-152 (272) Show / Hide 
Range on Protein: 22-50
Range on HMM: 126-152/272
Sequence Identity: 48% (14 aa)

GWVHRDLSAGNILALRDGPNKKWQVKLSD
| ||||. | |.|   | |    .|||.|
GLVHRDVAARNVLVFEDQP--RMYVKLTD
Kinase CC1G_09358.AA IKK 24-65 33 0.000988 8.83 In-house 136-176 (297) Show / Hide 
Range on Protein: 24-65
Range on HMM: 136-176/297
Sequence Identity: 33% (14 aa)

VHRDLSAGNILALRDGPNKKWQVKLSDLEYAKRFPSDDHCAS
||||.  |||  ....  |.   |. |..||.. . |  ..|
VHRDIKPGNIMCQKGEDGKTIY-KITDFGYAREWDDDEMFMS