CC1G_07022

Species: C.cinerea
Alias: CC1G_07022
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07022.AA Protein None 727 None Fasta, JSON
CC1G_07022.NA RNA None 2184 None Fasta, JSON
CC1G_07022.kin_dom Protein Kinase Domain None 415 None Fasta, JSON

Protein domain

Protein domains of CC1G_07022.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07022.AA ROCK 425-483 33 0.000473 9.33 In-house 118-171 (263) Show / Hide
Range on Protein: 425-483
Range on HMM: 118-171/263
Sequence Identity: 33% (20 aa)

GWVHRDVSPGNVLAYRESPTSTWTVKLSDLEHAKRFPDPGSIGRDPITGTPSFIACEVL
|..|||| | |.|       .   .|| |     .    | .  |   ||| .|. |||
GFIHRDVKPDNMLL-----DKYGHLKLADFGTCMKMNKNGMVRCDTAVGTPDYISPEVL