Gene AqueK046 (A.queenslandica)

AqueK046

Species: A.queenslandica
Alias: AqueK046
External Links:
Annotation:

Classification

Group: Atypical
Family: PIKK
Subfamily: FRAP

Sequence

Name Sequence Type Origin Length Description Download
AqueK046.AA Protein None 179 None Fasta, JSON

Protein domain

Protein domains of AqueK046.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Rapamycin_bind AqueK046.AA Rapamycin_bind 113-168 71 2.3e-41 132.35 Pfam 1-56 (100) Show / Hide 
Range on Protein: 113-168
Range on HMM: 1-56/100
Sequence Identity: 71% (40 aa)

ELIRVAILWHEQWHETLEDASRMYFGEHNVQGMFKVLDPLHQKLDKGPETLKEISF
|||||||||||.||| ||.|||.|||.||...||..|.|||..|.|||||..||||
ELIRVAILWHEMWHEGLEEASRQYFGDHNIEKMFNILEPLHEMLEKGPETMREISF