Gene AqueK206 (A.queenslandica)
AqueK206
Species: A.queenslandica
Alias: AqueK206
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| AqueK206.AA | Protein | None | 457 | None | Fasta, JSON |
| AqueK206.kin_dom | Protein Kinase Domain | None | 151 | None | Fasta, JSON |
Protein domains of AqueK206.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | AqueK206.AA | Slob | 135-155 | 36 | 0.000117 | 11.84 | In-house | 1-22 (268) | Show / Hide |
Range on Protein: 135-155 Range on HMM: 1-22/268 Sequence Identity: 36% (8 aa) LPDIGSRISKSWFMVR-PISGG | .||.|. |.|.|.. ..| LDHIGWRHRKNWCMMKNDMQPG |
|||||||||
| Kinase | AqueK206.AA | Slob | 195-337 | 26 | 1.9e-27 | 90.62 | In-house | 100-268 (268) | Show / Hide |
Range on Protein: 195-337
Range on HMM: 100-268/268
Sequence Identity: 26% (46 aa)
PSLPWSTKY------------------SVRRSGLRTHQIQNFGRQILEAVLFVHELGFKPFGQIQSGNIYLEG--GRCRVSGIDNAILGYKPRVS---RN
| || .|| . ..|| |.| ..|||||| .| |. || .| |||. . . . || |.| | || .|. . .
PKMPWARKYCNKQPKSSSSSSSSSSSSHKKQNGLPMKQVQKYCRQILEALIFLHSKGFP-YGHLHSGNVMIDDSNDCCRLSDIENCLLGMPPFYNDYIMW
VK--TYKENIDSVMFGHLLFELGSGKELSNPAPIE---SDYKNVKNQQVVEVLQFIFQSRIPPTIDEILQL
. .||.| . |||.|.| | .. |. .. . .. . ... |. ||. ..||
HRKIHEIENVDVYCFGHCLYEMCCGYPMQNHSVRNFPPCPFIALFCDKEHILSCEICKHCM-PTMRQLLQM
|
|||||||||
| Kinase | AqueK206.AA | CLK | 213-233 | 33 | 0.000272 | 7.98 | In-house | 114-134 (350) | Show / Hide |
Range on Protein: 213-233 Range on HMM: 114-134/350 Sequence Identity: 33% (7 aa) HQIQNFGRQILEAVLFVHELG ..|.....|..||| | |... DHIRHMAYQLCEAVKFLHDMK |
|||||||||
| Kinase | AqueK206.AA | CLK | 329-340 | 50 | 0.068995 | 0.63 | In-house | 339-350 (350) | Show / Hide |
Range on Protein: 329-340 Range on HMM: 339-350/350 Sequence Identity: 50% (6 aa) PTIDEILQLPFF .| ...|| ||| ITCKDALQHPFF |
|||||||||