Protein (view, download) , Domain (view, download)
ULK4_Hsap_ULK           ME----------------------------------------------------------
ULK3_Hsap_ULK           MAGPGWG-----------------------------------------------------
ULK2_Hsap_ULK           MEV---------------------------------------------------------
ULK1_Hsap_ULK           MEPGRG------------------------------------------------------
Fused_Hsap_Fused        ME----------------------------------------------------------
Fused_Mmus_Fused        ME----------------------------------------------------------
APG1_Scer_ULK           MGDIKNKDH---------------------------------------------------
fu_Dmel_Fused           MN----------------------------------------------------------
CG10967_Dmel_ULK        MNI---------------------------------------------------------
CG8866_Dmel_ULK         MSLP--------------------------------------------------------
ULK1_Mmus_ULK           MEPGRG------------------------------------------------------
ULK2_Mmus_ULK           MEV---------------------------------------------------------
ULK3_Mmus_ULK           MAGPSWG-----------------------------------------------------
ULK4_Mmus_ULK           ME----------------------------------------------------------
T07F12.4_Cele_ULK       MPDFTNKQI---------------------------------------------------
unc-51_Cele_ULK         MEQ---------------------------------------------------------
Apg1_Ddis_ULK           MKR---------------------------------------------------------
DDB0230007_Ddis_ULK     MPI---------------------------------------------------------
tsunami_Ddis_Fused      MDD---------------------------------------------------------
6347_Tthe_ULK           MNLMVNE-----------------------------------------------------
13031_Tthe_ULK          MAQAQNQSQK--------------------------------------------------
9755_Tthe_ULK           MENQRIQSFTL-------------------------------------------------
2332_Tthe_ULK           MNQENSDEQK--------------------------------------------------
9454_Tthe_ULK           MQI---------------------------------------------------------
16220_Tthe_ULK          MQINY-------------------------------------------------------
19068_Tthe_ULK          MDSQQKEQKI--------------------------------------------------
22937_Tthe_ULK          MIESFSGNL---------------------------------------------------
26140_Tthe_ULK          MNRVNIDAPVI------------------------------V------------------
28647_Tthe_ULK          MDQEGEQQISQ-------------------------------Q-----------------
5444_Tthe_ULK           MFRIKKMLNF--------------------------------------------------
8897_Tthe_ULK           MDLIKFMIEV-SICSYYIINKQL-------------------------------------
10447_Tthe_ULK          MYFQNVIEFQ--------------------------------------------------
11042_Tthe_ULK          MYQELIATQQ--------------------------------------------------
11253_Tthe_ULK          MSK---------------------------------------------------------
11660_Tthe_ULK          MKFISNDYF-----------------------------------N----Q----N-----
1348_Tthe_ULK           MSYNNQVLTYN-------------------------------Q-----------------
1349_Tthe_ULK           MVDHPQDQKDW-------------------------------------------------
13838_Tthe_ULK          MNGNLC------------------------------------------------------
1429_Tthe_ULK           MCKKSK------------------------------------------------------
1439_Tthe_ULK           MNFIKKINNYV-------------------------------------------------
14572_Tthe_ULK          MDFQKQ------------------------------------------------------
15010_Tthe_ULK          MNTIIAENPRN-------------------------------LIN----Q----N-----
15044_Tthe_ULK          MNMIFIPGT---------------------------------------------------
15069_Tthe_ULK          MNGVNSPNFKQNIQQEEDGNQQVK------------------------------------
15675_Tthe_ULK          MKTQVNQI----------------------------------------------------
15705_Tthe_ULK          MLPAPISKQC--------------------------------------------------
15762_Tthe_ULK          MYIHTLYFGFK------------AKSRKNKLYPIKEMDQKQGK-----------------
15836_Tthe_ULK          MYENIVQNTT--------------------------------------------------
15837_Tthe_ULK          MELRPD------------------------------------------------------
1647_Tthe_Fused         ME----------------------------------------------------------
16588_Tthe_ULK          MKQNQN------------------------------------------------------
18315_Tthe_ULK          MNN---------------------------------------------------------
18701_Tthe_ULK          MSDQT-------------------------------------------------------
18780_Tthe_ULK          MGKVKT------------------------------------------------------
19558_Tthe_ULK          MSDRNQ------------------------------------------------------
19707_Tthe_ULK          MSK---------------------------------------------------------
20769_Tthe_ULK          MYQFSMPNIQI--------------------------------G----------------
20902_Tthe_ULK          MRQQKEGQEQM-------------------------------------------------
2103_Tthe_ULK           MDQRYNNPPYS---------------------------------N----QQQYYNNNTIN
21109_Tthe_ULK          MNPDQQAKQDK-------------------------------------------------
21913_Tthe_ULK          MAV---------------------------------------------------------
22048_Tthe_ULK          MDQKASN-----------------------------------------------------
22049_Tthe_ULK          M-----------------------------------------------------------
24363_Tthe_ULK          MSSKDA------------------------------------------------------
24887_Tthe_ULK          MKQQTAKQNLQ-------------------------------A-----------------
24896_Tthe_ULK          MDLLLKY-----------------------------------------------------
26436_Tthe_ULK          MAK---------------------------------------------------------
26742_Tthe_ULK          MQQQYQIIRPS-------------------------------FTVVQPGSQAQKQIPHTK
27664_Tthe_ULK          MNLQKTP-----------------------------------------------------
28079_Tthe_ULK          MADNR-------------------------------------------------------
2836_Tthe_ULK           MKREEQDRKS--------------------------------------------------
28933_Tthe_ULK          MKLQSFVPTTI-------------------------------------------------
29387_Tthe_ULK          MIAI--------------------------------------------------------
30213_Tthe_ULK          MISF--------------------------------------------------------
3032_Tthe_ULK           MTEGSDW-----------------------------------------------------
3104_Tthe_ULK           MSGK--------------------------------------------------------
3833_Tthe_ULK           MATKKEKGLQV-------------------------------------------------
4111_Tthe_ULK           MDDWV-------------------------------------------------------
5362_Tthe_ULK           MSSGSN------------------------------------------------------
5380_Tthe_ULK           MSSSQLQSQNQ-------------------------------N-----------------
5688_Tthe_ULK           MSRQ--------------------------------------------------------
6603_Tthe_ULK           MEMYCLMNTGK-------------------------------E-----------------
7377_Tthe_ULK           MNKIH-------------------------------------------------------
8181_Tthe_ULK           MSEY--------------------------------------------------------
8636_Tthe_ULK           V-----------------------------------------------------------
8696_Tthe_ULK           MSNSEEK-----------------------------------------------------
9457_Tthe_ULK           MEWEC-------------------------------------------------------
ULK1_Spur_ULK           MEH---------------------------------------------------------
Fused_Spur_Fused        MK----------------------------------------------------------
ULK3_Spur_ULK           MAL---------------------------------------------------------
ULK4_Spur_ULK           MIAYSIGSVRD-------------------------------F-----------------
CC1G_15592_Ccin_ULK     MPPIPGPS----------------------------------------------------
AqueK209_Aque_Fused     ME----------------------------------------------------------
AqueK210_Aque_ULK       ------------------------------------------------------------
AqueK211_Aque_ULK       MAQ---------------------------------------------------------
AqueK212_Aque_ULK       MASASGIRGN--------------------------------------------------
AqueK213_Aque_ULK       MGNSFYFN----------------------------------------------------
AqueK214_Aque_ULK       ME----------------------------------------------------------
AqueK215_Aque_ULK       MAFRGKSS----------------------------------------------------
ULK_a_Smoe_ULK          MEDV--------------------------------------------------------
ULK_c_Smoe_ULK          MEQRAH------------------------------------------------------
ULK_d_Smoe_ULK          MEQRAH------------------------------------------------------
ULK_b_Smoe_ULK          MDQF--------------------------------------------------------
ULK-f2_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f5_Smoe_ULK-frag    MLWS--------------------------------------------------------
ULK-f3_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f1_Smoe_ULK-frag    SRY---------------------------------------------------------
ULK-f4_Smoe_ULK-frag    ------------------------------------------------------------
ULK-p1_Smoe_ULK-plant1  MG----------------------------------------------------------
ULK-p2_Smoe_ULK-plant2  MN----------------------------------------------------------
GK069_Glam_Fused        MHR---------------------------------------------------------
GK070_Glam_ULK          MNSA--------------------------------------------------------


ULK4_Hsap_ULK           ------------------------------------------------------------
ULK3_Hsap_ULK           ------------------------------------------------------------
ULK2_Hsap_ULK           ------------------------------------------------------------
ULK1_Hsap_ULK           ------------------------------------------------------------
Fused_Hsap_Fused        ------------------------------------------------------------
Fused_Mmus_Fused        ------------------------------------------------------------
APG1_Scer_ULK           ------------------------------------------------------------
fu_Dmel_Fused           ------------------------------------------------------------
CG10967_Dmel_ULK        ------------------------------------------------------------
CG8866_Dmel_ULK         ------------------------------------------------------------
ULK1_Mmus_ULK           ------------------------------------------------------------
ULK2_Mmus_ULK           ------------------------------------------------------------
ULK3_Mmus_ULK           ------------------------------------------------------------
ULK4_Mmus_ULK           ------------------------------------------------------------
T07F12.4_Cele_ULK       ------------------------------------------------------------
unc-51_Cele_ULK         ------------------------------------------------------------
Apg1_Ddis_ULK           ------------------------------------------------------------
DDB0230007_Ddis_ULK     ------------------------------------------------------------
tsunami_Ddis_Fused      ------------------------------------------------------------
6347_Tthe_ULK           ------------------------------------------------------------
13031_Tthe_ULK          ------------------------------------------------------------
9755_Tthe_ULK           ------------------------------------------------------------
2332_Tthe_ULK           ------------------------------------------------------------
9454_Tthe_ULK           ------------------------------------------------------------
16220_Tthe_ULK          ------------------------------------------------------------
19068_Tthe_ULK          ------------------------------------------------------------
22937_Tthe_ULK          ------------------------------------------------------------
26140_Tthe_ULK          ------------------------------------------------------------
28647_Tthe_ULK          ------------------------------------------------------------
5444_Tthe_ULK           ------------------------------------------------------------
8897_Tthe_ULK           ------------------------------------------------------------
10447_Tthe_ULK          ------------------------------------------------------------
11042_Tthe_ULK          ------------------------------------------------------------
11253_Tthe_ULK          ------------------------------------------------------------
11660_Tthe_ULK          ----------------------NQYF----QPNYFYNQNIPN--------------NQQQ
1348_Tthe_ULK           ---------------------------------------------------------YNQ
1349_Tthe_ULK           ------------------------------------------------------------
13838_Tthe_ULK          ------------------------------------------------------------
1429_Tthe_ULK           ------------------------------------------------------------
1439_Tthe_ULK           ------------------------------------------------------------
14572_Tthe_ULK          ------------------------------------------------------------
15010_Tthe_ULK          ----------------------KK------Q---------PS--------------IANG
15044_Tthe_ULK          ------------------------------------------------------------
15069_Tthe_ULK          ------------------------------------------------------------
15675_Tthe_ULK          ------------------------------------------------------------
15705_Tthe_ULK          ------------------------------------------------------------
15762_Tthe_ULK          ------------------------------------------------------------
15836_Tthe_ULK          ------------------------------------------------------------
15837_Tthe_ULK          ------------------------------------------------------------
1647_Tthe_Fused         ------------------------------------------------------------
16588_Tthe_ULK          ------------------------------------------------------------
18315_Tthe_ULK          ------------------------------------------------------------
18701_Tthe_ULK          ------------------------------------------------------------
18780_Tthe_ULK          ------------------------------------------------------------
19558_Tthe_ULK          ------------------------------------------------------------
19707_Tthe_ULK          ------------------------------------------------------------
20769_Tthe_ULK          ----------------------------------------------------------GA
20902_Tthe_ULK          ------------------------------------------------------------
2103_Tthe_ULK           RVPITQHNAYNYQGINNVPGQQNRYISMNQQ---------PSSQNYQQRQYYQQPT----
21109_Tthe_ULK          ------------------------------------------------------------
21913_Tthe_ULK          ------------------------------------------------------------
22048_Tthe_ULK          ------------------------------------------------------------
22049_Tthe_ULK          ------------------------------------------------------------
24363_Tthe_ULK          ------------------------------------------------------------
24887_Tthe_ULK          ---------------------------------------------------------AQA
24896_Tthe_ULK          ------------------------------------------------------------
26436_Tthe_ULK          ------------------------------------------------------------
26742_Tthe_ULK          LVGGSSINQVNLLG----------------------------------------------
27664_Tthe_ULK          ------------------------------------------------------------
28079_Tthe_ULK          ------------------------------------------------------------
2836_Tthe_ULK           ------------------------------------------------------------
28933_Tthe_ULK          ------------------------------------------------------------
29387_Tthe_ULK          ------------------------------------------------------------
30213_Tthe_ULK          ------------------------------------------------------------
3032_Tthe_ULK           ------------------------------------------------------------
3104_Tthe_ULK           ------------------------------------------------------------
3833_Tthe_ULK           ------------------------------------------------------------
4111_Tthe_ULK           ------------------------------------------------------------
5362_Tthe_ULK           ------------------------------------------------------------
5380_Tthe_ULK           ------------------------------------------------------------
5688_Tthe_ULK           ------------------------------------------------------------
6603_Tthe_ULK           ------------------------------------------------------------
7377_Tthe_ULK           ------------------------------------------------------------
8181_Tthe_ULK           ------------------------------------------------------------
8636_Tthe_ULK           ------------------------------------------------------------
8696_Tthe_ULK           ------------------------------------------------------------
9457_Tthe_ULK           ------------------------------------------------------------
ULK1_Spur_ULK           ------------------------------------------------------------
Fused_Spur_Fused        ------------------------------------------------------------
ULK3_Spur_ULK           ------------------------------------------------------------
ULK4_Spur_ULK           -------------------------------------------------------KK---
CC1G_15592_Ccin_ULK     ------------------------------------------------------------
AqueK209_Aque_Fused     ------------------------------------------------------------
AqueK210_Aque_ULK       ------------------------------------------------------------
AqueK211_Aque_ULK       ------------------------------------------------------------
AqueK212_Aque_ULK       ------------------------------------------------------------
AqueK213_Aque_ULK       --------------------------------------------------------ID--
AqueK214_Aque_ULK       ------------------------------------------------------------
AqueK215_Aque_ULK       ------------------------------------------------------------
ULK_a_Smoe_ULK          ------------------------------------------------------------
ULK_c_Smoe_ULK          ------------------------------------------------------------
ULK_d_Smoe_ULK          ------------------------------------------------------------
ULK_b_Smoe_ULK          ------------------------------------------------------------
ULK-f2_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f5_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f3_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f1_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f4_Smoe_ULK-frag    ------------------------------------------------------------
ULK-p1_Smoe_ULK-plant1  ------------------------------------------------------------
ULK-p2_Smoe_ULK-plant2  ------------------------------------------------------------
GK069_Glam_Fused        ------------------------------------------------------------
GK070_Glam_ULK          ------------------------------------------------------------


ULK4_Hsap_ULK           ------------------------------------------------------------
ULK3_Hsap_ULK           ------------------------------------------------------------
ULK2_Hsap_ULK           ------------------------------------------------------------
ULK1_Hsap_ULK           ------------------------------------------------------------
Fused_Hsap_Fused        ------------------------------------------------------------
Fused_Mmus_Fused        ------------------------------------------------------------
APG1_Scer_ULK           ------------------------------------------------------------
fu_Dmel_Fused           ------------------------------------------------------------
CG10967_Dmel_ULK        ------------------------------------------------------------
CG8866_Dmel_ULK         ------------------------------------------------------------
ULK1_Mmus_ULK           ------------------------------------------------------------
ULK2_Mmus_ULK           ------------------------------------------------------------
ULK3_Mmus_ULK           ------------------------------------------------------------
ULK4_Mmus_ULK           ------------------------------------------------------------
T07F12.4_Cele_ULK       ------------------------------------------------------------
unc-51_Cele_ULK         ------------------------------------------------------------
Apg1_Ddis_ULK           ------------------------------------------------------------
DDB0230007_Ddis_ULK     ------------------------------------------------------------
tsunami_Ddis_Fused      ------------------------------------------------------------
6347_Tthe_ULK           ------------------------------------------------------------
13031_Tthe_ULK          ------------------------------------------------------------
9755_Tthe_ULK           ------------------------------------------------------------
2332_Tthe_ULK           ------------------------------------------------------------
9454_Tthe_ULK           ------------------------------------------------------------
16220_Tthe_ULK          ------------------------------------------------------------
19068_Tthe_ULK          ------------------------------------------------------------
22937_Tthe_ULK          ------------------------------------------------------------
26140_Tthe_ULK          ------------------------------------------------------------
28647_Tthe_ULK          ------------------------------------------------------------
5444_Tthe_ULK           ------------------------------------------------------------
8897_Tthe_ULK           ------------------------------------------------------------
10447_Tthe_ULK          ------------------------------------------------------------
11042_Tthe_ULK          ------------------------------------------------------------
11253_Tthe_ULK          ------------------------------------------------------------
11660_Tthe_ULK          -------------------------------------------NFYNNNKNNFQFNNQQQ
1348_Tthe_ULK           QQPAQQLQQQPQQQQQYQPYPPHSAAMMQNNYQNMPPQKINNQMQQHQQINSKQPNPNQP
1349_Tthe_ULK           ------------------------------------------------------------
13838_Tthe_ULK          ------------------------------------------------------------
1429_Tthe_ULK           ------------------------------------------------------------
1439_Tthe_ULK           ------------------------------------------------------------
14572_Tthe_ULK          ------------------------------------------------------------
15010_Tthe_ULK          ------------------------------------------------------------
15044_Tthe_ULK          ------------------------------------------------------------
15069_Tthe_ULK          ------------------------------------------------------------
15675_Tthe_ULK          ------------------------------------------------------------
15705_Tthe_ULK          ------------------------------------------------------------
15762_Tthe_ULK          ------------------------------------------------------------
15836_Tthe_ULK          ------------------------------------------------------------
15837_Tthe_ULK          ------------------------------------------------------------
1647_Tthe_Fused         ------------------------------------------------------------
16588_Tthe_ULK          ------------------------------------------------------------
18315_Tthe_ULK          ------------------------------------------------------------
18701_Tthe_ULK          ------------------------------------------------------------
18780_Tthe_ULK          ------------------------------------------------------------
19558_Tthe_ULK          ------------------------------------------------------------
19707_Tthe_ULK          ------------------------------------------------------------
20769_Tthe_ULK          ------------------------------------------------------------
20902_Tthe_ULK          ------------------------------------------------------------
2103_Tthe_ULK           ------------------------------------------------------------
21109_Tthe_ULK          ------------------------------------------------------------
21913_Tthe_ULK          ------------------------------------------------------------
22048_Tthe_ULK          ------------------------------------------------------------
22049_Tthe_ULK          ------------------------------------------------------------
24363_Tthe_ULK          ------------------------------------------------------------
24887_Tthe_ULK          NQLG--------------------------------------------------------
24896_Tthe_ULK          ------------------------------------------------------------
26436_Tthe_ULK          ------------------------------------------------------------
26742_Tthe_ULK          ------------------------------------------------------------
27664_Tthe_ULK          ------------------------------------------------------------
28079_Tthe_ULK          ------------------------------------------------------------
2836_Tthe_ULK           ------------------------------------------------------------
28933_Tthe_ULK          ------------------------------------------------------------
29387_Tthe_ULK          ------------------------------------------------------------
30213_Tthe_ULK          ------------------------------------------------------------
3032_Tthe_ULK           ------------------------------------------------------------
3104_Tthe_ULK           ------------------------------------------------------------
3833_Tthe_ULK           ------------------------------------------------------------
4111_Tthe_ULK           ------------------------------------------------------------
5362_Tthe_ULK           ------------------------------------------------------------
5380_Tthe_ULK           ------------------------------------------------------------
5688_Tthe_ULK           ------------------------------------------------------------
6603_Tthe_ULK           ------------------------------------------------------------
7377_Tthe_ULK           ------------------------------------------------------------
8181_Tthe_ULK           ------------------------------------------------------------
8636_Tthe_ULK           ------------------------------------------------------------
8696_Tthe_ULK           ------------------------------------------------------------
9457_Tthe_ULK           ------------------------------------------------------------
ULK1_Spur_ULK           ------------------------------------------------------------
Fused_Spur_Fused        ------------------------------------------------------------
ULK3_Spur_ULK           ------------------------------------------------------------
ULK4_Spur_ULK           ------------------------------------------------------------
CC1G_15592_Ccin_ULK     ------------------------------------------------------------
AqueK209_Aque_Fused     ------------------------------------------------------------
AqueK210_Aque_ULK       ------------------------------------------------------------
AqueK211_Aque_ULK       ------------------------------------------------------------
AqueK212_Aque_ULK       ------------------------------------------------------------
AqueK213_Aque_ULK       ------------------------------------------------------------
AqueK214_Aque_ULK       ------------------------------------------------------------
AqueK215_Aque_ULK       ------------------------------------------------------------
ULK_a_Smoe_ULK          ------------------------------------------------------------
ULK_c_Smoe_ULK          ------------------------------------------------------------
ULK_d_Smoe_ULK          ------------------------------------------------------------
ULK_b_Smoe_ULK          ------------------------------------------------------------
ULK-f2_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f5_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f3_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f1_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f4_Smoe_ULK-frag    ------------------------------------------------------------
ULK-p1_Smoe_ULK-plant1  ------------------------------------------------------------
ULK-p2_Smoe_ULK-plant2  ------------------------------------------------------------
GK069_Glam_Fused        ------------------------------------------------------------
GK070_Glam_ULK          ------------------------------------------------------------


ULK4_Hsap_ULK           ------------------------------------------------------------
ULK3_Hsap_ULK           ------------------------------------------------------------
ULK2_Hsap_ULK           ------------------------------------------------------------
ULK1_Hsap_ULK           ------------------------------------------------------------
Fused_Hsap_Fused        ------------------------------------------------------------
Fused_Mmus_Fused        ------------------------------------------------------------
APG1_Scer_ULK           ------------------------------------------------------------
fu_Dmel_Fused           ------------------------------------------------------------
CG10967_Dmel_ULK        ------------------------------------------------------------
CG8866_Dmel_ULK         ------------------------------------------------------------
ULK1_Mmus_ULK           ------------------------------------------------------------
ULK2_Mmus_ULK           ------------------------------------------------------------
ULK3_Mmus_ULK           ------------------------------------------------------------
ULK4_Mmus_ULK           ------------------------------------------------------------
T07F12.4_Cele_ULK       ------------------------------------------------------------
unc-51_Cele_ULK         ------------------------------------------------------------
Apg1_Ddis_ULK           ------------------------------------------------------------
DDB0230007_Ddis_ULK     ------------------------------------------------------------
tsunami_Ddis_Fused      ------------------------------------------------------------
6347_Tthe_ULK           ------------------------------------------------------------
13031_Tthe_ULK          ------------------------------------------------------------
9755_Tthe_ULK           ------------------------------------------------------------
2332_Tthe_ULK           ------------------------------------------------------------
9454_Tthe_ULK           ------------------------------------------------------------
16220_Tthe_ULK          ------------------------------------------------------------
19068_Tthe_ULK          ------------------------------------------------------------
22937_Tthe_ULK          ------------------------------------------------------------
26140_Tthe_ULK          ------------------------------------------------------------
28647_Tthe_ULK          ------------------------------------------------------------
5444_Tthe_ULK           ------------------------------------------------------------
8897_Tthe_ULK           ------------------------------------------------------------
10447_Tthe_ULK          ------------------------------------------------------------
11042_Tthe_ULK          ------------------------------------------------------------
11253_Tthe_ULK          ------------------------------------------------------------
11660_Tthe_ULK          NNNIYQYNNGLTSPYGNN------------------------------------Y---IN
1348_Tthe_ULK           LPQGNP-----------QRQMSNNQ-------------QMNIQNQ---QQ----------
1349_Tthe_ULK           ------------------------------------------------------------
13838_Tthe_ULK          ------------------------------------------------------------
1429_Tthe_ULK           ------------------------------------------------------------
1439_Tthe_ULK           ------------------------------------------------------------
14572_Tthe_ULK          ------------------------------------------------------------
15010_Tthe_ULK          -----------------N------------------------------------AVNEAN
15044_Tthe_ULK          ------------------------------------------------------------
15069_Tthe_ULK          ------------------------------------------------------------
15675_Tthe_ULK          ------------------------------------------------------------
15705_Tthe_ULK          ------------------------------------------------------------
15762_Tthe_ULK          ------------------------------------------------------------
15836_Tthe_ULK          ------------------------------------------------------------
15837_Tthe_ULK          ------------------------------------------------------------
1647_Tthe_Fused         ------------------------------------------------------------
16588_Tthe_ULK          ------------------------------------------------------------
18315_Tthe_ULK          ------------------------------------------------------------
18701_Tthe_ULK          ------------------------------------------------------------
18780_Tthe_ULK          ------------------------------------------------------------
19558_Tthe_ULK          ------------------------------------------------------------
19707_Tthe_ULK          ------------------------------------------------------------
20769_Tthe_ULK          -----------------N------------------------------------IL---N
20902_Tthe_ULK          ------------------------------------------------------------
2103_Tthe_ULK           --------------------------------------------VNQQ------QI---Q
21109_Tthe_ULK          ------------------------------------------------------------
21913_Tthe_ULK          ------------------------------------------------------------
22048_Tthe_ULK          ------------------------------------------------------------
22049_Tthe_ULK          ------------------------------------------------------------
24363_Tthe_ULK          ------------------------------------------------------------
24887_Tthe_ULK          ----GQATIAIPSSNTPNLQQQKAQQ----------GSQQNVQ-Q---QQ----------
24896_Tthe_ULK          ------------------------------------------------------------
26436_Tthe_ULK          ------------------------------------------------------------
26742_Tthe_ULK          --------------------------------------------VNQQQGQQPQQI---Q
27664_Tthe_ULK          ------------------------------------------------------------
28079_Tthe_ULK          ------------------------------------------------------------
2836_Tthe_ULK           ------------------------------------------------------------
28933_Tthe_ULK          ------------------------------------------------QGQ--PII---Q
29387_Tthe_ULK          ------------------------------------------------------------
30213_Tthe_ULK          ------------------------------------------------------------
3032_Tthe_ULK           ------------------------------------------------------------
3104_Tthe_ULK           ------------------------------------------------------------
3833_Tthe_ULK           ------------------------------------------------------------
4111_Tthe_ULK           ------------------------------------------------------------
5362_Tthe_ULK           ------------------------------------------------------------
5380_Tthe_ULK           -------------------------S----------GGNQN---G---MQ----------
5688_Tthe_ULK           ------------------------------------------------------------
6603_Tthe_ULK           -------------------------V---ALDN---SSNKT---F---NC----------
7377_Tthe_ULK           ------------------------------------------------------------
8181_Tthe_ULK           ------------------------------------------------------------
8636_Tthe_ULK           ------------------------------------------------------------
8696_Tthe_ULK           ------------------------------------------------------------
9457_Tthe_ULK           ------------------------------------------------------------
ULK1_Spur_ULK           ------------------------------------------------------------
Fused_Spur_Fused        ------------------------------------------------------------
ULK3_Spur_ULK           ------------------------------------------------------------
ULK4_Spur_ULK           ------------------------------------------------------------
CC1G_15592_Ccin_ULK     ------------------------------------------------------------
AqueK209_Aque_Fused     ------------------------------------------------------------
AqueK210_Aque_ULK       ------------------------------------------------------------
AqueK211_Aque_ULK       ------------------------------------------------------------
AqueK212_Aque_ULK       -------------------------PSGNP-GQSLRPTRRT---VTSSIAPVR-------
AqueK213_Aque_ULK       -------------------------YSGCGISHSLL--SLS---LSS--LPLS-------
AqueK214_Aque_ULK       ------------------------------------------------------------
AqueK215_Aque_ULK       ------------------------------------------------------------
ULK_a_Smoe_ULK          ------------------------------------------------------------
ULK_c_Smoe_ULK          ------------------------------------------------------------
ULK_d_Smoe_ULK          ------------------------------------------------------------
ULK_b_Smoe_ULK          ------------------------------------------------------------
ULK-f2_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f5_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f3_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f1_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f4_Smoe_ULK-frag    ------------------------------------------------------------
ULK-p1_Smoe_ULK-plant1  ------------------------------------------------------------
ULK-p2_Smoe_ULK-plant2  ------------------------------------------------------------
GK069_Glam_Fused        ------------------------------------------------------------
GK070_Glam_ULK          ------------------------------------------------------------


ULK4_Hsap_ULK           ------------------------------------------------------------
ULK3_Hsap_ULK           ------------------------------------------------------------
ULK2_Hsap_ULK           ------------------------------------------------------------
ULK1_Hsap_ULK           ------------------------------------------------------------
Fused_Hsap_Fused        ------------------------------------------------------------
Fused_Mmus_Fused        ------------------------------------------------------------
APG1_Scer_ULK           ---------------------------------------T--------------------
fu_Dmel_Fused           ------------------------------------------------------------
CG10967_Dmel_ULK        ------------------------------------------------------------
CG8866_Dmel_ULK         ------------------------------------------------------------
ULK1_Mmus_ULK           ------------------------------------------------------------
ULK2_Mmus_ULK           ------------------------------------------------------------
ULK3_Mmus_ULK           ------------------------------------------------------------
ULK4_Mmus_ULK           ------------------------------------------------------------
T07F12.4_Cele_ULK       ------------------------------------------------------------
unc-51_Cele_ULK         ------------------------------------------------------------
Apg1_Ddis_ULK           ------------------------------------------------------------
DDB0230007_Ddis_ULK     ------------------------------------------------------------
tsunami_Ddis_Fused      ------------------------------------------------------------
6347_Tthe_ULK           ------------------------------------------------------------
13031_Tthe_ULK          ------------------------------------------------------------
9755_Tthe_ULK           ---------------------------------------K--------------------
2332_Tthe_ULK           ------------------------------------------------------------
9454_Tthe_ULK           ------------------------------------------------------------
16220_Tthe_ULK          ------------------------------------------------------------
19068_Tthe_ULK          ------------------------------------------------------------
22937_Tthe_ULK          ------------------------------------------------------------
26140_Tthe_ULK          ------------------------------------------------------------
28647_Tthe_ULK          ---------------------------------------D--------------------
5444_Tthe_ULK           ------------------------------------------------------------
8897_Tthe_ULK           ------------------------------------------------------------
10447_Tthe_ULK          ------------------------------------------------------------
11042_Tthe_ULK          ------------------------------------------------------------
11253_Tthe_ULK          ------------------------------------------------------------
11660_Tthe_ULK          Q-------QNQPINQQQYQVNQPFYHQEKQNYLQQNNIQY--------------------
1348_Tthe_ULK           ---------------------------------------P--------------------
1349_Tthe_ULK           ---------------------------------------K--------------------
13838_Tthe_ULK          ------------------------------------------------------------
1429_Tthe_ULK           ------------------------------------------------------------
1439_Tthe_ULK           ------------------------------------------------------------
14572_Tthe_ULK          ------------------------------------------------------------
15010_Tthe_ULK          T-------KN------------------------KMHSQQ--------------------
15044_Tthe_ULK          ------------------------------------------------------------
15069_Tthe_ULK          ---------------------------------------R--------------------
15675_Tthe_ULK          --------------------------------------------------------GGEK
15705_Tthe_ULK          --------------------------------------------------------FDSK
15762_Tthe_ULK          ---------------------------------------G--------------------
15836_Tthe_ULK          ------------------------------------------------------------
15837_Tthe_ULK          ------------------------------------------------------------
1647_Tthe_Fused         ------------------------------------------------------------
16588_Tthe_ULK          ------------------------------------------------------------
18315_Tthe_ULK          ------------------------------------------------------------
18701_Tthe_ULK          ------------------------------------------------------------
18780_Tthe_ULK          ------------------------------------------------------------
19558_Tthe_ULK          ------------------------------------------------------------
19707_Tthe_ULK          ------------------------------------------------------------
20769_Tthe_ULK          N-------PN------------------------QQSING--------------------
20902_Tthe_ULK          ------------------------------------------------------------
2103_Tthe_ULK           QQQQRQQAFS------------------------QKT-----------------------
21109_Tthe_ULK          ---------------------------------------QAAQQQKMQKQGASVECKASE
21913_Tthe_ULK          ------------------------------------------------------------
22048_Tthe_ULK          ------------------------------------------------------------
22049_Tthe_ULK          ------------------------------------------------------------
24363_Tthe_ULK          ------------------------------------------------------------
24887_Tthe_ULK          ---------------------------------------Q--------------------
24896_Tthe_ULK          ------------------------------------------------------------
26436_Tthe_ULK          ------------------------------------------------------------
26742_Tthe_ULK          QQQQIQVQQN------------------------QSQQPQ--------------------
27664_Tthe_ULK          ------------------------------------------------------------
28079_Tthe_ULK          ------------------------------------------------------------
2836_Tthe_ULK           ------------------------------------------------------------
28933_Tthe_ULK          QQN-GVIGQN------------------------Q----G--------------------
29387_Tthe_ULK          ------------------------------------------------------------
30213_Tthe_ULK          ------------------------------------------------------------
3032_Tthe_ULK           ------------------------------------------------------------
3104_Tthe_ULK           ------------------------------------------------------------
3833_Tthe_ULK           ---------------------------------------V--------------------
4111_Tthe_ULK           ------------------------------------------------------------
5362_Tthe_ULK           ------------------------------------------------------------
5380_Tthe_ULK           ---------------------------------------N--------------------
5688_Tthe_ULK           ------------------------------------------------------------
6603_Tthe_ULK           ---------------------------------------Q--------------------
7377_Tthe_ULK           ------------------------------------------------------------
8181_Tthe_ULK           ------------------------------------------------------------
8636_Tthe_ULK           ------------------------------------------------------------
8696_Tthe_ULK           ------------------------------------------------------------
9457_Tthe_ULK           ------------------------------------------------------------
ULK1_Spur_ULK           ------------------------------------------------------------
Fused_Spur_Fused        ------------------------------------------------------------
ULK3_Spur_ULK           ------------------------------------------------------------
ULK4_Spur_ULK           ---------------------------------------K--------------------
CC1G_15592_Ccin_ULK     ---------------------------------------S--------------------
AqueK209_Aque_Fused     ------------------------------------------------------------
AqueK210_Aque_ULK       ------------------------------------------------------------
AqueK211_Aque_ULK       ------------------------------------------------------------
AqueK212_Aque_ULK       ------------------------------------------------------------
AqueK213_Aque_ULK       ---------------------------------------L--------------------
AqueK214_Aque_ULK       ------------------------------------------------------------
AqueK215_Aque_ULK       ------------------------------------------------------------
ULK_a_Smoe_ULK          ------------------------------------------------------------
ULK_c_Smoe_ULK          ------------------------------------------------------------
ULK_d_Smoe_ULK          ------------------------------------------------------------
ULK_b_Smoe_ULK          ------------------------------------------------------------
ULK-f2_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f5_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f3_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f1_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f4_Smoe_ULK-frag    ------------------------------------------------------------
ULK-p1_Smoe_ULK-plant1  ------------------------------------------------------------
ULK-p2_Smoe_ULK-plant2  ------------------------------------------------------------
GK069_Glam_Fused        ------------------------------------------------------------
GK070_Glam_ULK          ------------------------------------------------------------


ULK4_Hsap_ULK           ------------------------------------------------------------
ULK3_Hsap_ULK           ------------------------------------------------------------
ULK2_Hsap_ULK           ------------------------------------------------------------
ULK1_Hsap_ULK           ------------------------------------------------------------
Fused_Hsap_Fused        ------------------------------------------------------------
Fused_Mmus_Fused        ------------------------------------------------------------
APG1_Scer_ULK           ------------------------------------------------------------
fu_Dmel_Fused           ------------------------------------------------------------
CG10967_Dmel_ULK        ------------------------------------------------------------
CG8866_Dmel_ULK         ------------------------------------------------------------
ULK1_Mmus_ULK           ------------------------------------------------------------
ULK2_Mmus_ULK           ------------------------------------------------------------
ULK3_Mmus_ULK           ------------------------------------------------------------
ULK4_Mmus_ULK           ------------------------------------------------------------
T07F12.4_Cele_ULK       ------------------------------------------------------------
unc-51_Cele_ULK         ------------------------------------------------------------
Apg1_Ddis_ULK           ------------------------------------------------------------
DDB0230007_Ddis_ULK     ------------------------------------------------------------
tsunami_Ddis_Fused      ------------------------------------------------------------
6347_Tthe_ULK           ------------------------------------------------------------
13031_Tthe_ULK          -K----------------------------------------------------------
9755_Tthe_ULK           ------------------------------------------------------------
2332_Tthe_ULK           -K----------------------------------------------------------
9454_Tthe_ULK           ------------------------------------------------------------
16220_Tthe_ULK          ------------------------------------------------------------
19068_Tthe_ULK          ------------------------------------------------------------
22937_Tthe_ULK          ------------------------------------------------------------
26140_Tthe_ULK          ------------------------------------------------------------
28647_Tthe_ULK          ------------------------------------------------------------
5444_Tthe_ULK           ------------------------------------------------------------
8897_Tthe_ULK           ------------------------------------------------------------
10447_Tthe_ULK          ------------------------------------------------------------
11042_Tthe_ULK          -I------INNYLL-ISQQL-------------------V--------------------
11253_Tthe_ULK          ------------------------------------------------------------
11660_Tthe_ULK          ------------------------------------------------------------
1348_Tthe_ULK           ------------------------------------------------------------
1349_Tthe_ULK           -S----------------------------------------------------------
13838_Tthe_ULK          ------------------------------------------------------------
1429_Tthe_ULK           --LVLVKIEGSFQL-KNKQISASIQIHKNKNLRFVHKKLLKSKKKKQFNQEKKKEIRRRR
1439_Tthe_ULK           ------------------------------------------------------------
14572_Tthe_ULK          ------------------------------------------------------------
15010_Tthe_ULK          ------------------------------------------------------------
15044_Tthe_ULK          ------------------------------------------------------------
15069_Tthe_ULK          ------------------------------------------------------------
15675_Tthe_ULK          KG----------------------------------------------------------
15705_Tthe_ULK          QA----------------------------------------------------------
15762_Tthe_ULK          ------------------------------------------------------------
15836_Tthe_ULK          ------------------------------------------------------------
15837_Tthe_ULK          ------------------------------------------------------------
1647_Tthe_Fused         ------------------------------------------------------------
16588_Tthe_ULK          ------------------------------------------------------------
18315_Tthe_ULK          ------------------------------------------------------------
18701_Tthe_ULK          ------------------------------------------------------------
18780_Tthe_ULK          ------------------------------------------------------------
19558_Tthe_ULK          ------------------------------------------------------------
19707_Tthe_ULK          ------------------------------------------------------------
20769_Tthe_ULK          ------------------------------------------------------------
20902_Tthe_ULK          ------------------------------------------------------------
2103_Tthe_ULK           ------------------------------------------------------------
21109_Tthe_ULK          QGE---------------------------------------------------------
21913_Tthe_ULK          ------------------------------------------------------------
22048_Tthe_ULK          ------------------------------------------------------------
22049_Tthe_ULK          ------------------------------------------------------------
24363_Tthe_ULK          ------------------------------------------------------------
24887_Tthe_ULK          ------------------------------------------------------------
24896_Tthe_ULK          ------------------------------------------------------------
26436_Tthe_ULK          ------------------------------------------------------------
26742_Tthe_ULK          ------------------------------------------------------------
27664_Tthe_ULK          ------------------------------------------------------------
28079_Tthe_ULK          ------------------------------------------------------------
2836_Tthe_ULK           -E---------FITLLQKQE-------------------N--------------------
28933_Tthe_ULK          ------------------------------------------------------------
29387_Tthe_ULK          ------------------------------------------------------------
30213_Tthe_ULK          ------------------------------------------------------------
3032_Tthe_ULK           ------------------------------------------------------------
3104_Tthe_ULK           ------------------------------------------------------------
3833_Tthe_ULK           -R----------------------------------------------------------
4111_Tthe_ULK           ------------------------------------------------------------
5362_Tthe_ULK           ------------------------------------------------------------
5380_Tthe_ULK           ------------------------------------------------------------
5688_Tthe_ULK           ------------------------------------------------------------
6603_Tthe_ULK           ------------------------------------------------------------
7377_Tthe_ULK           ------------------------------------------------------------
8181_Tthe_ULK           ------------------------------------------------------------
8636_Tthe_ULK           ------------------------------------------------------------
8696_Tthe_ULK           ------------------------------------------------------------
9457_Tthe_ULK           ------------------------------------------------------------
ULK1_Spur_ULK           ------------------------------------------------------------
Fused_Spur_Fused        ------------------------------------------------------------
ULK3_Spur_ULK           ------------------------------------------------------------
ULK4_Spur_ULK           ------------------------------------------------------------
CC1G_15592_Ccin_ULK     ------------------------------------------------------------
AqueK209_Aque_Fused     ------------------------------------------------------------
AqueK210_Aque_ULK       ------------------------------------------------------------
AqueK211_Aque_ULK       ------------------------------------------------------------
AqueK212_Aque_ULK       ------------------------------------------------------------
AqueK213_Aque_ULK       ------------------------------------------------------------
AqueK214_Aque_ULK       ------------------------------------------------------------
AqueK215_Aque_ULK       ------------------------------------------------------------
ULK_a_Smoe_ULK          ------------------------------------------------------------
ULK_c_Smoe_ULK          ------------------------------------------------------------
ULK_d_Smoe_ULK          ------------------------------------------------------------
ULK_b_Smoe_ULK          ------------------------------------------------------------
ULK-f2_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f5_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f3_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f1_Smoe_ULK-frag    ------------------------------------------------------------
ULK-f4_Smoe_ULK-frag    ------------------------------------------------------------
ULK-p1_Smoe_ULK-plant1  ------------------------------------------------------------
ULK-p2_Smoe_ULK-plant2  ------------------------------------------------------------
GK069_Glam_Fused        ------------------------------------------------------------
GK070_Glam_ULK          ------------------------------------------------------------


ULK4_Hsap_ULK           ------------------------------------------------------------
ULK3_Hsap_ULK           ------------------------------------------------------------
ULK2_Hsap_ULK           ------------------------------------------------------------
ULK1_Hsap_ULK           ------------------------------------------------------------
Fused_Hsap_Fused        ------------------------------------------------------------
Fused_Mmus_Fused        ------------------------------------------------------------
APG1_Scer_ULK           ---------------------T------------------------------S-------
fu_Dmel_Fused           ------------------------------------------------------------
CG10967_Dmel_ULK        ------------------------------------------------------------
CG8866_Dmel_ULK         ------------------------------------------------------------
ULK1_Mmus_ULK           ------------------------------------------------------------
ULK2_Mmus_ULK           ------------------------------------------------------------
ULK3_Mmus_ULK           ------------------------------------------------------------
ULK4_Mmus_ULK           ------------------------------------------------------------
T07F12.4_Cele_ULK       ------------------------------------------------------------
unc-51_Cele_ULK         ------------------------------------------------------------
Apg1_Ddis_ULK           ------------------------------------------------------------
DDB0230007_Ddis_ULK     ------------------------------------------------------------
tsunami_Ddis_Fused      ------------------------------------------------------------
6347_Tthe_ULK           ------------------------------------------------------------
13031_Tthe_ULK          ------------------------------------------------------------
9755_Tthe_ULK           ------------------------------------------------------------
2332_Tthe_ULK           ----------------------------------------------------R-------
9454_Tthe_ULK           ------------------------------------------------------------
16220_Tthe_ULK          ------------------------------------------------------------
19068_Tthe_ULK          ------------------------------------------------------------
22937_Tthe_ULK          ------------------------------------------------------------
26140_Tthe_ULK          ---------------------R------------------------------S-------
28647_Tthe_ULK          ---------------------L------------------------------E-------
5444_Tthe_ULK           ------------------------------------------------------------
8897_Tthe_ULK           ----------------------------------------------------Y-------
10447_Tthe_ULK          ------------------------------------------------------------
11042_Tthe_ULK          ---------SKQGQ-------M------------------------------DQ---K--
11253_Tthe_ULK          ------------------------------------------------------------
11660_Tthe_ULK          ---------------------Q------------------------------Q-------
1348_Tthe_ULK           ------------------QQIN--------------------------------------
1349_Tthe_ULK           ------------------------------------------------------------
13838_Tthe_ULK          ----------------------