Gene AqueK164 (A.queenslandica)
AqueK164
Species: A.queenslandica
Alias: AqueK164
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| AqueK164.AA | Protein | None | 583 | None | Fasta, JSON |
| AqueK164.kin_dom | Protein Kinase Domain | None | 254 | None | Fasta, JSON |
Protein domains of AqueK164.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kelch_1 | AqueK164.AA | Kelch_1 | 13-69 | 14 | 0.109933 | 9.81 | Pfam | 1-45 (45) | Show / Hide |
Range on Protein: 13-69 Range on HMM: 1-45/45 Sequence Identity: 14% (8 aa) ERAAHCTVSVDDSLYVWAGYQDGLPGVHDSEEKRKVTSNIQHFTPSSGQWITRSTTG |. |. ..... .|| |. . .... . |...|| .. . PRCGHGVCVHNGKIYVIGGCDG------------QYLNSVECYDPETNQWTRCPPMP |
|||||||||
| Kelch_2 | AqueK164.AA | Kelch_2 | 13-69 | 15 | 0.434832 | 8.26 | Pfam | 1-51 (51) | Show / Hide |
Range on Protein: 13-69 Range on HMM: 1-51/51 Sequence Identity: 15% (9 aa) ERAAHCTVSVDDSLYVWAGYQDGLPGVHDSEEKRKVTSNIQHFTPSSGQWITRSTTG |. | ...... .||. || .. .. .... |. . |.. .| . . PRYCHASCVPGGKIYVFGGYC------RHTHNNDCWSMDIWWWDPETHRWTCVPRMP |
|||||||||
| Kelch_1 | AqueK164.AA | Kelch_1 | 74-121 | 25 | 0.000175 | 19.84 | Pfam | 1-45 (45) | Show / Hide |
Range on Protein: 74-121 Range on HMM: 1-45/45 Sequence Identity: 25% (12 aa) GVRSYCCTSINDQLYYFGGYCGHDYCYHNSITQLDTVSLQWRELEPTD ........|...| .||..| | ||. .|... ||... | PRCGHGVCVHNGKIYVIGGCDG---QYLNSVECYDPETNQWTRCPPMP |
|||||||||
| Kelch_2 | AqueK164.AA | Kelch_2 | 74-121 | 17 | 0.004294 | 15.88 | Pfam | 1-51 (51) | Show / Hide |
Range on Protein: 74-121 Range on HMM: 1-51/51 Sequence Identity: 17% (9 aa) GVRSYCCTSINDQLYYFGGY---CGHDYCYHNSITQLDTVSLQWRELEPTD . . ........| |||| ... |....| .|. . .|... . . PRYCHASCVPGGKIYVFGGYCRHTHNNDCWSMDIWWWDPETHRWTCVPRMP |
|||||||||
| Kelch_1 | AqueK164.AA | Kelch_1 | 279-308 | 16 | 0.360675 | 7.96 | Pfam | 14-41 (45) | Show / Hide |
Range on Protein: 279-308 Range on HMM: 14-41/45 Sequence Identity: 16% (5 aa) LVISGGFDKNIDTLDDCWIFNITQHSWIKL . . ||.| |....... . ..| .. IYVIGGCDG--QYLNSVECYDPETNQWTRC |
|||||||||
| Kelch_2 | AqueK164.AA | Kelch_2 | 279-312 | 18 | 0.83668 | 7.18 | Pfam | 14-51 (51) | Show / Hide |
Range on Protein: 279-312 Range on HMM: 14-51/51 Sequence Identity: 18% (7 aa) LVISGGF----DKNIDTLDDCWIFNITQHSWIKLDVPH ....||. . | . . | |... |.| .. ... IYVFGGYCRHTHNNDCWSMDIWWWDPETHRWTCVPRMP |
|||||||||
| Kinase | AqueK164.AA | MOS | 546-574 | 37 | 7.3e-05 | 11.82 | In-house | 1-28 (299) | Show / Hide |
Range on Protein: 546-574 Range on HMM: 1-28/299 Sequence Identity: 37% (11 aa) VTLTKEELGRGSYAVVTVGIFRGLRVAVK |.| .. .||| . | .....| .|||| VCL-CQMIGRGGFGSVWKAQYCGRPVAVK |
|||||||||
| Kinase | AqueK164.AA | TKL | 553-578 | 27 | 0.000348 | 10.98 | In-house | 1-36 (364) | Show / Hide |
Range on Protein: 553-578 Range on HMM: 1-36/364 Sequence Identity: 27% (10 aa) LGRGSYAVVTVGIFRG----------LRVAVKSLHT .|.|....| |..|| |||| ... IGSGGFGEVYKGKWRGWGGKCPSDTGKDVAVKKFKS |
|||||||||
| Kinase | AqueK164.AA | TAK1 | 547-574 | 32 | 0.000488 | 9.42 | In-house | 1-28 (284) | Show / Hide |
Range on Protein: 547-574 Range on HMM: 1-28/284 Sequence Identity: 32% (9 aa) TLTKEELGRGSYAVVTVGIFRGLRVAVK .... .|.|.| || .|. ..||| IQNEHFVGKGTYGVVCKAKWRNKEIAVK |
|||||||||
| Kinase | AqueK164.AA | TKL-Unique | 549-577 | 37 | 0.000518 | 10.25 | In-house | 1-29 (290) | Show / Hide |
Range on Protein: 549-577 Range on HMM: 1-29/290 Sequence Identity: 37% (11 aa) TKEELGRGSYAVVTVGIFRGLRVAVKSLH . .|.|.|..| |..|| ||.|..| FWNKIGEGGYGQVYKGKWRGYPVAIKQFH |
|||||||||
| Kinase | AqueK164.AA | Dicty4 | 549-577 | 41 | 0.000588 | 9.28 | In-house | 3-33 (277) | Show / Hide |
Range on Protein: 549-577 Range on HMM: 3-33/277 Sequence Identity: 41% (13 aa) TKEELGRGSYAVVTVGIFRGLRVAVKSL--H . ...|.||.. | |. || |||| | | IEQRIGKGSFGEVYKGTWRGKEVAVKKLNNH |
|||||||||
| Kinase | AqueK164.AA | Gdt | 550-574 | 44 | 0.000924 | 8.77 | In-house | 4-28 (289) | Show / Hide |
Range on Protein: 550-574 Range on HMM: 4-28/289 Sequence Identity: 44% (11 aa) KEELGRGSYAVVTVGIFRGLRVAVK || .. |.. .| ||.|.. |||| KEYCSQGTFGMVYKGIWRSSQVAVK |
|||||||||