Gene CDK11_c (S.moellendorffii)
CDK11_c
Species: S.moellendorffii
Alias: CDK11_c
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CDK11_c.AA | Protein | None | 589 | None | Fasta, JSON |
| CDK11_c.NA | RNA | None | 1770 | None | Fasta, JSON |
| CDK11_c.kin_dom | Protein Kinase Domain | None | 33 | None | Fasta, JSON |
Protein domains of CDK11_c.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | CDK11_c.AA | PITSLRE | 78-122 | 63 | 3.2e-25 | 88.85 | In-house | 1-47 (295) | Show / Hide |
Range on Protein: 78-122 Range on HMM: 1-47/295 Sequence Identity: 63% (30 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVKMV--HERDGFPMTS |. ||.|.|||||| |||.||. .|||||||.|| |..||| || FQCLNRIHEGTYGVVYRAKDKRTDEIVALKRLKMERQKEKEGFPITS |
|||||||||
| Kinase | CDK11_c.AA | CDK | 78-122 | 49 | 1.6e-23 | 71.94 | In-house | 1-55 (284) | Show / Hide |
Range on Protein: 78-122 Range on HMM: 1-55/284 Sequence Identity: 49% (27 aa) FERLNKIDEGTYGVLYRARDKKSG-----EIVALKRVKMVH-----ERDGFPMTS .|.|.|| |||||| |.||||..| .|||||...| . |..|||.|. YEKLEKIGEGTYGVVYKARDKQTGRKKTGQIVALKKIRMENEGREEEKEGFPITA |
|||||||||
| Kinase | CDK11_c.AA | CDK10 | 78-122 | 60 | 4.8e-21 | 69.72 | In-house | 1-45 (285) | Show / Hide |
Range on Protein: 78-122 Range on HMM: 1-45/285 Sequence Identity: 60% (27 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVKMVHERDGFPMTS ||.||.. |||||. ||||| .| ||||||.|.| .|.|| |. . FEKLNRVGEGTYGIVYRARDMRSDEIVALKKVRMDKEKDGLPISG |
|||||||||
| Kinase | CDK11_c.AA | CDC2 | 78-122 | 40 | 8.6e-21 | 60.15 | In-house | 1-47 (301) | Show / Hide |
Range on Protein: 78-122 Range on HMM: 1-47/301 Sequence Identity: 40% (19 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVKMVHERDG--FPMTS .....|| |||||| |...|.....|||||... .| .| .| |. YQKIEKIGEGTYGVVYKCKDMQTNQIVALKKIRLEQEDEGDGVPSTA |
|||||||||
| Kinase | CDK11_c.AA | CRK7 | 78-122 | 47 | 6.9e-19 | 61.58 | In-house | 1-48 (343) | Show / Hide |
Range on Protein: 78-122 Range on HMM: 1-48/343 Sequence Identity: 47% (23 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVKMVHE---RDGFPMTS .|... | ||||| | |..|. ||.||||.|.| .| ..||| |. YEMIMQIGEGTYGQVYKAKNKHTGEMVALKKVRMDNEKIKKEGFPITA |
|||||||||
| Kinase | CDK11_c.AA | CDK5 | 78-121 | 54 | 2e-18 | 54.38 | In-house | 1-44 (287) | Show / Hide |
Range on Protein: 78-121 Range on HMM: 1-44/287 Sequence Identity: 54% (24 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVKMVHERDGFPMT .|...|| |||||. |.||.|...||||||||.. | | | | YEKMEKIGEGTYGTVYKARNKETHEIVALKRVRLDSEDEGVPST |
|||||||||
| Kinase | CDK11_c.AA | CMGC | 78-122 | 33 | 7.8e-16 | 47.63 | In-house | 1-68 (513) | Show / Hide |
Range on Protein: 78-122 Range on HMM: 1-68/513 Sequence Identity: 33% (23 aa) FERLNKIDEGTYGVLYRARD--------------KKSGEIVALKRVK---MVH------ERDGFPMTS .| ..|| |||||| |..|| ....||||.|..| . . |.||||... YEIIKKIGEGTYGVVYKCRDKRTNQKKDNGQAHHHETNEIVAIKKIKNPFYEEQAKSTIEKDGFPIRA |
|||||||||
| Kinase | CDK11_c.AA | CDK7 | 78-113 | 37 | 3.4e-14 | 33.79 | In-house | 1-37 (288) | Show / Hide |
Range on Protein: 78-113 Range on HMM: 1-37/288 Sequence Identity: 37% (14 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVK-MVH .| . .| ||.... |.|.|...|.||| |..| . | YEKIKHIGEGQFATVYKACDHQTGQIVAIKKIKKLGH |
|||||||||
| Kinase | CDK11_c.AA | CDK4 | 78-120 | 42 | 1.2e-12 | 39.48 | In-house | 1-45 (290) | Show / Hide |
Range on Protein: 78-120 Range on HMM: 1-45/290 Sequence Identity: 42% (19 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVKMVHERD--GFPM .. .. | || || ||||| ..| .||||.|. . . | || YQCVAEIGEGAYGTVYRARDLHTGHFVALKQVRIPIGEEGGGMPM |
|||||||||
| Kinase | CDK11_c.AA | CDK9 | 78-121 | 38 | 2.1e-12 | 38.88 | In-house | 1-55 (340) | Show / Hide |
Range on Protein: 78-121 Range on HMM: 1-55/340 Sequence Identity: 38% (21 aa) FERLNKIDEGTYG-----------VLYRARDKKSGEIVALKRVKMVHERDGFPMT .|.|.|| ||.| ..|| || . .||.|.| | |. ||| | YEKLAKIGQGTFGQVLQGRKSRNSEVFKARHKKNKRMVAMKKVLMENEKEGFPIT |
|||||||||
| Kinase | CDK11_c.AA | Pkinase | 78-124 | 34 | 8.5e-07 | 25.12 | Pfam | 1-47 (293) | Show / Hide |
Range on Protein: 78-124 Range on HMM: 1-47/293 Sequence Identity: 34% (16 aa) FERLNKIDEGTYGVLYRARDKKSGEIVALKRVKMVHERDGFPMTSRK .... || .|..|. |....|..|.|||.|..| .||......| |. YHIGRKIGSGSFGCVYKCHHKGTGKIVAVKIIKKRHEKSWKDQTHRR |
|||||||||
| Exo_endo_phos | CDK11_c.AA | Exo_endo_phos | 246-393 | 13 | 5e-06 | 22.93 | Pfam | 94-200 (200) | Show / Hide |
Range on Protein: 246-393 Range on HMM: 94-200/200 Sequence Identity: 13% (20 aa) APGDSRGAKGNRDPRDLRGRLCRILKRGRRIIIVGHLNISPYPIDSCDPGPKF-DTDPSRQWFRSLLVSEGGAFSDSFRVFHPEIAEAYTCWSQASGAEE .... . . |.. .|.. .| |.. .|..| .|. . .|. .. . ... ...| .||.|.. ... PWHG-WFDQRNQQYWDIYDFLQF---RHDPWIWCGDFNYRHDEWDY-NWK-RRKMWW------------------------EHPITFPYTWWYYRNTSRK FNYGSRIDHVLIAGPCAGHCQCPDGSHENSSCDGFAECGTDMCDILLEF |....||... | . .. .. ..| . . | | ....| HNTPWWIDYIWWSG-WM-RV-WC-IHDE--------HMPSDHCPVYATF |
|||||||||
| Zf-GRF | CDK11_c.AA | zf-GRF | 547-575 | 50 | 1e-08 | 34.47 | Pfam | 1-30 (49) | Show / Hide |
Range on Protein: 547-575 Range on HMM: 1-30/49 Sequence Identity: 50% (15 aa) LSCKGHG-ETCVVRTVKKAGPNLGRGFYVC |...| ||..||.| ||| || ||.| PLCPMCGPQRCVIKTVRKTGPNPGRQFYKC |
|||||||||