Protein (view, download) , Domain (view, download)
Akt1_Dmel                           MSINT--------TFDLSSPSVTSGHALT-EQ----------------------------
AKT3_Mmus                           MSDVT-------------------------------------------------------
AKT2_Mmus                           MNEVS-------------------------------------------------------
AKT1_Mmus                           MNDVA-------------------------------------------------------
akt-2_Cele                          MSTENAHLQ----------------------K----------------------------
akt-1_Cele                          MSMTSLSTK----S--------------R-RQ----------------------------
SCH9_Scer                           MMNFFTSK-----S--------------S-NQ----------------------------
YPK1_Scer                           MYSWKSK-F----K--------------F-GK----------------------------
YPK2_Scer                           MHSWRISKF----K--------------L-GR----------------------------
AKT3_Hsap                           MSDVT-------------------------------------------------------
AKT2_Hsap                           MNEVS-------------------------------------------------------
AKT1_Hsap                           MSDVA-------------------------------------------------------
Akt1_Ddis                           MSTAPIKH-----E--------------G-FL----------------------------
DDB0220670_Ddis                     MLKDIYNSL---------------------------------------------------
14576_Tthe                          MSHSQLSTK----E--------------V-LPF---------------------------
1560_Tthe                           MDTENNQ-F---------------------------------------------------
18079_Tthe                          MRIIIQY-Y------------------------------YDFLRKKTAAIDIEDEESDCS
18101_Tthe                          MDNLIKEF-----D--------------ELKL----------------------------
19784_Tthe                          MGNVCPSEA-------------------S-K-----------------------------
20271_Tthe                          MGNSLCMEQ-------------------K-V-----------------------------
20554_Tthe                          MKKSELEDLIEKFD--------------TLSF----------------------------
23891_Tthe                          MIKLRE-VR----I--------------H-KSSTHLTYSI--------------------
3020_Tthe                           MRLIGRVCG-------------------I-KN----------------------------
3983_Tthe                           MDNLAETF-----D--------------ELNL----------------------------
5269_Tthe                           ME----------------------------------------------------------
5665_Tthe                           MNNLNNI-N---------------------------------------------------
6414_Tthe                           MMNHQQQ-Y---------------------------------------------------
26010_Tthe                          MDISQSSLN----N--------------L-E-----------------------------
26470_Tthe                          MQGNWPA-A---------------------------------------------------
26009_Tthe                          MDTINQ-VN----I--------------I-E-----------------------------
11909_Tthe_RSK                      MGTLCAKE-----E--------------K-------------------------------
2547_Tthe                           MGACLSVF-----G--------------G-KP----------------------------
10523_Tthe_Ciliate-E2-Unclassified  MNNKRLDSG----Q--------------H-QD----------------------------
AktB_Spur                           MDDFDVLKV---------------------------------------------------
AktA_Spur                           MTTTMSVSE---------------------AP----------------------------
CC1G_09916_Ccin                     MSWKLGVK-----K--------------S-KD----------------------------
CC1G_00081_Ccin                     MSSPSPSS-----S--------------S-PL----------------------------
CC1G_03026_Ccin                     MSWLRGKK-----S--------------V-SN----------------------------
AqueK001_Aque                       MAEKGAPPK----E--------------S-GD----------------------------
AqueK002_Aque                       MAGREV------------------------------------------------------
AqueK003_Aque                       MLKRIGLGL----T--------------SVCSS---------------------------
GK001_Glam                          MSDTDVRI-----K--------------Y-------------------------------
                                    *

Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ---------------------------------------TKE------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ---------------------------------------TQSE-----------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          VLLKAISVKIDRQIHDFIATVKKDNI----------------------------------
18101_Tthe                          ---------------------------------------SKE------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ---------------------------------------TKE------------------
23891_Tthe                          -----------------------NDIHKRYYKKLQKIQLQKQKYTCGEEHNIASRSKTSN
3020_Tthe                           ---------------------------------------PKA------------------
3983_Tthe                           ---------------------------------------GCE------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ---------------------------------------DNE------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          ----------------------SVRIIQGWPLSFYEIKEKQILNVEFKEFESQESNAPQL
18101_Tthe                          ---------------------------------------KS-------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ---------------------------------------KS-------------------
23891_Tthe                          ILQLQRLHDSNLDLGETLDQGGG-------------------------------------
3020_Tthe                           ---------------------------------------FQ-------------------
3983_Tthe                           ---------------------------------------KS-------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          IIEENLKYLFCIQQKKQGQVLNQRYLMKLGFNKMQDRNLSVIKDYEEEEGDEENEADNSF
18101_Tthe                          II----------------------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          IL----------------------------------------------------------
23891_Tthe                          ------------------------------------------------------------
3020_Tthe                           IH----------------------------------------------------------
3983_Tthe                           LS----------------------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          GRKKSYFQQKDRTSQNKKVGSQYSNSSSSDEESGRTKNIDLKKILENFLEQLIIETQNNR
18101_Tthe                          ------------------------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ------------------------------------------------------------
23891_Tthe                          ------------------------------------------------------------
3020_Tthe                           ------------------------------------------------------------
3983_Tthe                           ------------------------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          LEEVKKLFNEVSDRLTQEQKDELQKQKLVIINNLGKRGSNPLHVAVYNQFYELTKELVER
18101_Tthe                          -----------------------------------KHL------------SAD-------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          -----------------------------------KLI------------DPD-------
23891_Tthe                          ------------------------------------------------------------
3020_Tthe                           -----------------------------------IDE------------TED-------
3983_Tthe                           -----------------------------------KQF------------NEG-------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          GANVNVPSNQGWTSVQIAIFKNNIKILKLLLDSQSLDLNYVSSVGTPLTVCCQFSKAQAL
18101_Tthe                          ------------------------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ------------------------------------------------------------
23891_Tthe                          ------------------------------------------------------------
3020_Tthe                           ------------------------------------------------------------
3983_Tthe                           ------------------------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          DLVLKKNPDLSILDQSGKSCFDHCQNEECKNILKSFKQKEAIEEQKQNELKSEIKSNQQN
18101_Tthe                          ------------------------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ------------------------------------------------------------
23891_Tthe                          ------------------------------------------------------------
3020_Tthe                           ------------------------------------------------------------
3983_Tthe                           ------------------------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           ---------TQVV-----------------------------------------------
AKT3_Mmus                           -----------IV-----------------------------------------------
AKT2_Mmus                           -----------VI-----------------------------------------------
AKT1_Mmus                           -----------IV-----------------------------------------------
akt-2_Cele                          ---------EDIV-----------------------------------------------
akt-1_Cele                          ---------EDVV-----------------------------------------------
SCH9_Scer                           ------------D-----------------------------------------------
YPK1_Scer                           ------------S-----------------------------------------------
YPK2_Scer                           ------------S-----------------------------------------------
AKT3_Hsap                           -----------IV-----------------------------------------------
AKT2_Hsap                           -----------VI-----------------------------------------------
AKT1_Hsap                           -----------IV-----------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------NSPQALENNKQTADKYLDYYDNLGSFMIKDLDSGVSYDAREEKKIEEI
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          QQPGVFLPPKPPI-----------------------------------------------
18101_Tthe                          ---------EQIV-----------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ---------EKIL-----------------------------------------------
23891_Tthe                          -----------AL-----------------------------------------------
3020_Tthe                           ---------INSL-----------------------------------------------
3983_Tthe                           ---------EKII-----------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ---------WDLL-----------------------------------------------
AktB_Spur                           ------------L-----------------------------------------------
AktA_Spur                           ---------ITVI-----------------------------------------------
CC1G_09916_Ccin                     ------------T-----------------------------------------------
CC1G_00081_Ccin                     ------------S-----------------------------------------------
CC1G_03026_Ccin                     ------------L-----------------------------------------------
AqueK001_Aque                       ---------RLIV-----------------------------------------------
AqueK002_Aque                       ----------TVV-----------------------------------------------
AqueK003_Aque                       ----------CVG-----------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           -----------KEGWL-----------------MKRG---E--HIKNWRQRYF-------
AKT3_Mmus                           -----------KEGWV-----------------QKRG---E--YIKNWRPRYF-------
AKT2_Mmus                           -----------KEGWL-----------------HKRG---E--YIKTWRPRYF-------
AKT1_Mmus                           -----------KEGWL-----------------HKRG---E--YIKTWRPRYF-------
akt-2_Cele                          -----------IESWL-----------------HKKG---E--HIRNWRPRYF-------
akt-1_Cele                          -----------IEGWL-----------------HKKG---E--HIRNWRPRYF-------
SCH9_Scer                           -------------TG------------------FS---------SQHQHPNG------Q-
YPK1_Scer                           -----------KEEKE-----------------AKH-------------SGFFHSSKKEE
YPK2_Scer                           -----------KEDDG-----------------SSED---E--NEKSWGNGLFHFHHGEK
AKT3_Hsap                           -----------KEGWV-----------------QKRG---E--YIKNWRPRYF-------
AKT2_Hsap                           -----------KEGWL-----------------HKRG---E--YIKTWRPRYF-------
AKT1_Hsap                           -----------KEGWL-----------------HKRG---E--YIKTWRPRYF-------
Akt1_Ddis                           ------------------------------------G---G--GFKSWKKRWF-------
DDB0220670_Ddis                     ---------------L-----------------SKKQ---EESNMAAWNNEDI-------
14576_Tthe                          NSKYDVITPVAEQGQT-----------------KAWNDYWR--QIKRMKEDFF-------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          -----------VTGTL-----------------FKIG---A--FLFNMRERFF-------
18101_Tthe                          -----------ASFNV-----------------FKYN---E--YLN-RQERTL-------
19784_Tthe                          ---------------------------------NKIQ---R--QID--------------
20271_Tthe                          ---------------------------------EKNQ---Q--KTK--------------
20554_Tthe                          -----------LTCMI-----------------QKYN---R--KNK-RQERNL-------
23891_Tthe                          -----------CDNYV-----------------QSKN---N--QLN-SRSRDY-------
3020_Tthe                           -----------KRIFEEKTGIPIQYQILTTIVEGQYI---K--VIEGWTLEFY-------
3983_Tthe                           -----------MSCNI-----------------YKFN---D--YKR-RQERNL-------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      --------------QI-----------------NQN----E-------------------
2547_Tthe                           ------------------------------------D---D--Q----------------
10523_Tthe_Ciliate-E2-Unclassified  -----------KI-----------------------------------------------
AktB_Spur                           -----------GKGTL-----------------GK-------------------------
AktA_Spur                           -----------KEGWV-----------------QKRE-----------------------
CC1G_09916_Ccin                     -----------KENGV-----------------ISRS---V--TPIPSRPTTP-------
CC1G_00081_Ccin                     -----------ASRGQ-----------------IH---------VKLISARA------L-
CC1G_03026_Ccin                     -----------KASED-----------------LSRA---T--TPTPENPNG--------
AqueK001_Aque                       -----------KEGWL-----------------QKRG---E--YIKNWRPRWF-------
AqueK002_Aque                       -----------KEGWL-----------------QKRG---E--YIKNWRPRWF-------
AqueK003_Aque                       -----------RDGAR-----------------NQRR--------------HQ-------
GK001_Glam                          --------------AV-----------------TKTS---S--RGK-KQPRSL-------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           --------NNGNNNSSTAGNDNGYPCKLVSSGPCASSNNGALFTNFTLQTATPTTAISQD
YPK1_Scer                           QQN--NQATAGEHDASIT------RS----------------------------------
YPK2_Scer                           HHDGSPKNHNHEHEHHIR------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          ------------------------------------------------------------
18101_Tthe                          ------------------------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ------------------------------------------------------------
23891_Tthe                          ------------------------------------------------------------
3020_Tthe                           ------------------------------------------------------------
3983_Tthe                           ------------------------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------------------------------------------------


Akt1_Dmel                           --------------------------------------------VLH-----------S-
AKT3_Mmus                           --------------------------------------------LLK-----------T-
AKT2_Mmus                           --------------------------------------------LLK-----------S-
AKT1_Mmus                           --------------------------------------------LLK-----------N-
akt-2_Cele                          --------------------------------------------ILF-----------R-
akt-1_Cele                          --------------------------------------------MIF-----------N-
SCH9_Scer                           LYAMGTTGITSENALFQMKSMNNGISSVNNN------NSN--------------------
YPK1_Scer                           --------------------------SLDRKGTINPSNSSVVPVRVS-----------Y-
YPK2_Scer                           --------------------------KINTNETL-PS--SLSSPKLR-----------N-
AKT3_Hsap                           --------------------------------------------LLK-----------T-
AKT2_Hsap                           --------------------------------------------LLK-----------S-
AKT1_Hsap                           --------------------------------------------LLK-----------N-
Akt1_Ddis                           --------------------------------------------ILK-----------G-
DDB0220670_Ddis                     ---------------------------------------------LE-----------T-
14576_Tthe                          --------------------------------------------DCV-----------Q-
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          --------------------------------------------VIN-----------P-
18101_Tthe                          --------------------------------------------MIT-----------N-
19784_Tthe                          ----------------------------------------------------------E-
20271_Tthe                          ----------------------------------------------------------K-
20554_Tthe                          --------------------------------------------MIT-----------S-
23891_Tthe                          --------------------------------------------DIF-----------RL
3020_Tthe                           --------------------------------------------QFYDNQLINVHDFRK-
3983_Tthe                           --------------------------------------------LIT-----------T-
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     --------------------------------------------RMS-----------T-
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ----------------------------------------------K-----------Q-
AqueK001_Aque                       --------------------------------------------ILY-----------S-
AqueK002_Aque                       --------------------------------------------ILY-----------S-
AqueK003_Aque                       --------------------------------------------RLE-----------N-
GK001_Glam                          --------------------------------------------VLT-----------S-


Akt1_Dmel                           ----D-----------------------------------------GR------------
AKT3_Mmus                           ----D-----------------------------------------GS------------
AKT2_Mmus                           ----D-----------------------------------------GS------------
AKT1_Mmus                           ----D-----------------------------------------GT------------
akt-2_Cele                          ----D-----------------------------------------GT------------
akt-1_Cele                          ----D-----------------------------------------GA------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ----D-----------------------------------------AS------------
YPK2_Scer                           ----D-----------------------------------------AS------------
AKT3_Hsap                           ----D-----------------------------------------GS------------
AKT2_Hsap                           ----D-----------------------------------------GS------------
AKT1_Hsap                           ----D-----------------------------------------GT------------
Akt1_Ddis                           ----------------------------------------------GD------------
DDB0220670_Ddis                     ----Q-----------------------------------------AQ------------
14576_Tthe                          ----M-----------------------------------------GD------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          ---DE-----------------------------------------GT------------
18101_Tthe                          ----------------------------------------------KC------------
19784_Tthe                          ----D-----------------------------------------QS------------
20271_Tthe                          ----------------------------------------------S-------------
20554_Tthe                          ----------------------------------------------KG------------
23891_Tthe                          NSLSE-----------------------------------------GP------------
3020_Tthe                           ----GEFHFNHPSCQKKVVQDQLLQINAHYYRKLGLIGQSEEIEKIQSLDNSQLNACSDS
3983_Tthe                           ----------------------------------------------HA------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ----D-----------------------------------------G-------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ----A-----------------------------------------K-------------
AqueK001_Aque                       ----D-----------------------------------------GS------------
AqueK002_Aque                       ----D-----------------------------------------GS------------
AqueK003_Aque                       ----D-------------------------------------------------------
GK001_Glam                          ----K-----------------------------------------SV------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          ------------------------------------------------------------
18101_Tthe                          ------------------------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ------------------------------------------------------------
23891_Tthe                          ------------------------------------------------------------
3020_Tthe                           NILSTTLDNSIISTKATTPHSYSESEDGYSQQKFYQILQQFIKAIQDRKWKEAKQYLDLH
3983_Tthe                           ------------------------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------------------------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------------------------------------------------
AqueK002_Aque                       ------------------------------------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ---------QN-------------------------------------------------


Akt1_Dmel                           ---LM----------------------------GYRS-----------------------
AKT3_Mmus                           ---FI----------------------------GYKE-----------------------
AKT2_Mmus                           ---FI----------------------------GYKE-----------------------
AKT1_Mmus                           ---FI----------------------------GYKE-----------------------
akt-2_Cele                          ---LL----------------------------GFRS-----------------------
akt-1_Cele                          ---LL----------------------------GFRA-----------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ---SST-STVRDSNGGNSENTNSSQNLDETANIGSTG-----------------------
YPK2_Scer                           ---FKNPSGIGNDNSKA-SERKASQSSTET------------------------------
AKT3_Hsap                           ---FI----------------------------GYKE-----------------------
AKT2_Hsap                           ---FI----------------------------GYKE-----------------------
AKT1_Hsap                           ---FI----------------------------GYKE-----------------------
Akt1_Ddis                           ---LS----------------------------YYKT-----------------------
DDB0220670_Ddis                     ---L--------------------------------------------------------
14576_Tthe                          ---LI----------------------------GLRE-----------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          ---LI----------------------------RYKN-----------------------
18101_Tthe                          ---VY----------------------------NLKN-----------------------
19784_Tthe                          ---IN----------------------------GNKKT----------------------
20271_Tthe                          ---------------------------------GLQSS----------------------
20554_Tthe                          ---VY----------------------------GMSK-----------------------
23891_Tthe                          ---LS----------------------------TYDS-----------------------
3020_Tthe                           TTLLK----------------------------KYKKTKQQDIISELDSNGWNSLHYASY
3983_Tthe                           ---IY----------------------------NLNG-----------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ---------------------------------GLND-----------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ---FV----------------------------GFKA-----------------------
AqueK002_Aque                       ---FR----------------------------GFKN-----------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ---VM----------------------------GNSI-----------------------


Akt1_Dmel                           ------------------KPADS---A---------------------------------
AKT3_Mmus                           ------------------KPQDV---D---------------------------------
AKT2_Mmus                           ------------------RPEAP---D---------------------------------
AKT1_Mmus                           ------------------RPQDV---D---------------------------------
akt-2_Cele                          ------------------KPKED---Q---------------------------------
akt-1_Cele                          ------------------KPKEG---Q---------------------------------
SCH9_Scer                           ------------------TPT-IITTS---------------------------------
YPK1_Scer                           ------------------TPN---------------------------------------
YPK2_Scer                           --------------------Q---------------------------------------
AKT3_Hsap                           ------------------KPQDV---D---------------------------------
AKT2_Hsap                           ------------------RPEAP---D---------------------------------
AKT1_Hsap                           ------------------RPQDV---D---------------------------------
Akt1_Ddis                           ------------------KG--E---L---------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------ILDKQ---N---------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          ------------------KSH---------------------------------------
18101_Tthe                          ------------------HSIKR---V---------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ------------------KTLKR---K---------------------------------
23891_Tthe                          ------------------PTKDF---LDYSSAKNDVISNNIQTSVNSTDRSSVVTLTNKL
3020_Tthe                           LEFDDICRKLIIEGADLNKPTSD---D---------------------------------
3983_Tthe                           ------------------STIKR---K---------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ------------------------------------------------------------
10523_Tthe_Ciliate-E2-Unclassified  ------------------KMLKL---D---------------------------------
AktB_Spur                           ------------------------------------------------------------
AktA_Spur                           ------------------------------------------------------------
CC1G_09916_Ccin                     ------------------------------------------------------------
CC1G_00081_Ccin                     ------------------------------------------------------------
CC1G_03026_Ccin                     ------------------------------------------------------------
AqueK001_Aque                       ------------------KPAAA---D---------------------------------
AqueK002_Aque                       ------------------KPEDK---F---------------------------------
AqueK003_Aque                       ------------------------------------------------------------
GK001_Glam                          ------------------QWER--------------------------------------


Akt1_Dmel                           ------------------------------------------------------------
AKT3_Mmus                           ------------------------------------------------------------
AKT2_Mmus                           ------------------------------------------------------------
AKT1_Mmus                           ------------------------------------------------------------
akt-2_Cele                          ------------------------------------------------------------
akt-1_Cele                          ------------------------------------------------------------
SCH9_Scer                           ------------------------------------------------------------
YPK1_Scer                           ------------------------------------------------------------
YPK2_Scer                           ------------------------------------------------------------
AKT3_Hsap                           ------------------------------------------------------------
AKT2_Hsap                           ------------------------------------------------------------
AKT1_Hsap                           ------------------------------------------------------------
Akt1_Ddis                           ------------------------------------------------------------
DDB0220670_Ddis                     ------------------------------------------------------------
14576_Tthe                          ------------------------------------------------------------
1560_Tthe                           ------------------------------------------------------------
18079_Tthe                          ------------------------------------------------------------
18101_Tthe                          ------------------------------------------------------------
19784_Tthe                          ------------------------------------------------------------
20271_Tthe                          ------------------------------------------------------------
20554_Tthe                          ------------------------------------------------------------
23891_Tthe                          ASNYFENTQESYSNSNSVRQLSKEEVNLLQESFLQEIPEKPALIRGRVHRQVFSFIMRER
3020_Tthe                           ------------------------------------------------------------
3983_Tthe                           ------------------------------------------------------------
5269_Tthe                           ------------------------------------------------------------
5665_Tthe                           ------------------------------------------------------------
6414_Tthe                           ------------------------------------------------------------
26010_Tthe                          ------------------------------------------------------------
26470_Tthe                          ------------------------------------------------------------
26009_Tthe                          ------------------------------------------------------------
11909_Tthe_RSK                      ------------------------------------------------------------
2547_Tthe                           ---------------------------------</