Protein (view, download) , Domain (view, download)
CG17698_Dmel_CAMKK-Meta        MDLTDPLLI---TKSQ---------------------------QV---------------
CAMKK2_Mmus_CAMKK-Meta         MSSCVSSQP---TSDR---------------------------VA---------------
CAMKK1_Mmus_CAMKK-Meta         MESGPAVCC---QDPR---------------------------AE---------------
ckk-1_Cele_CAMKK-Meta          MYTFQSV-----------------------------------------------------
PAK1_Scer_ELM                  MDRSDKKVN---VEEV---------------------------NV-P-SN----------
ELM1_Scer_ELM                  MSPRQLIPT---LIPE---------------------------WA-P-------------
CaMKK1_Hsap_CAMKK-Meta         MEGGPAVCC---QDPR---------------------------AE---------------
CaMKK2_Hsap_CAMKK-Meta         MSSCVSSQP---SSNR---------------------------AA---------------
TOS3_Scer_ELM                  MVLLKEPVQ-----PL------------------------------P-R-----------
YGL059W_Scer_ELM               MSKYQINCI---RY--------------------------------R-HF----------
DDB0220010_Ddis_CAMKK-Meta     MGCIFTKPS-----PE---------------------------QQ----K----------
19056_Tthe_CAMKK-Unclassified  MQKENELIV---GDIS---------------------------E----------------
21621_Tthe_CAMKK-Unclassified  MSAESSQYG---TSNV---------------------------KK-K-KI----------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  MGCGSTRFQ---VQGNQPL------------------------SQ-KNKQCNDLNKYFDD
2641_Tthe_CAMKK-Unclassified   MGCANVRGV---------------------------------------------------
5409_Tthe_CAMKK-Unclassified   MGCGSSGIK---------------------------------------------------
5517_Tthe_CAMKK-Unclassified   MGSSPSKQA---LAFFYKIKFQVDQIIVILKNDVFFFQIRKKKQNEK-ND----------
8975_Tthe_CAMKK-Unclassified   MDFKFNLGG---AEEE---------------------------EE-E-QN----------
8976_Tthe_CAMKK-Unclassified   MNSPDNQAN---KIPE---------------------------QE----N----------
CAMKK_Spur_CAMKK-Meta          MGVNMVIEK---CNRN---------------------------KE----F----------
CC1G_14171_Ccin_ELM            MAQGGAMGY---QTPD---------------------------SL---------------
CC1G_07875_Ccin_ELM            MDDQGASSSGGLQNGD---------------------------SS---------------
AqueK153_Aque_CAMKK-Meta       MSTMEKEQA---KAPA---------------------------SN-T-FF----------
GK045_Glam_CAMKK-Unclassified  MDNKKLNKN---PMPS---------------------------G----------------


CG17698_Dmel_CAMKK-Meta        --------------------------------------------------NSQEVD----
CAMKK2_Mmus_CAMKK-Meta         --------------------------------------------------PQDELG----
CAMKK1_Mmus_CAMKK-Meta         --------------------------------------------------LVDRVA----
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  --------------------------------------------------LQIELE----
ELM1_Scer_ELM                  ---------------------------------------------------LSQQS----
CaMKK1_Hsap_CAMKK-Meta         --------------------------------------------------LVERVA----
CaMKK2_Hsap_CAMKK-Meta         --------------------------------------------------PQDELG----
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               --------------------------------------------------LR--------
DDB0220010_Ddis_CAMKK-Meta     --------------------------------------------------FD--------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  --------------------------------------------------LNDVIN----
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  LIDQHLFIFQYCKNRKLNKFYETKEIGIQTSYNNLYDKLESEKPPTPKQVRTEGVNIHNE
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   --------------------------------------------------LNQQQI----
8975_Tthe_CAMKK-Unclassified   --------------------------------------------------LDG-LN----
8976_Tthe_CAMKK-Unclassified   --------------------------------------------------YQE-------
CAMKK_Spur_CAMKK-Meta          --------------------------------------------------EYETIG----
CC1G_14171_Ccin_ELM            --------------------------------------------------QLE-------
CC1G_07875_Ccin_ELM            --------------------------------------------------QI--------
AqueK153_Aque_CAMKK-Meta       --------------------------------------------------IDGHLK----
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ---------------------------------F--QKKTEDTFPSKFHKNKASCGLLAV
CAMKK2_Mmus_CAMKK-Meta         ---------------------------------S--G-----------------------
CAMKK1_Mmus_CAMKK-Meta         ---------------------------------A--I-----------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ---------------------------------K--S-----------------------
ELM1_Scer_ELM                  ---------------------------------C--I-----------------------
CaMKK1_Hsap_CAMKK-Meta         ---------------------------------A--I-----------------------
CaMKK2_Hsap_CAMKK-Meta         ---------------------------------G--R-----------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------S-----------------------
21621_Tthe_CAMKK-Unclassified  ---------------------------------E--P-----------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  QNKSKDSDIFSFDNNNGGKTGQLEKVKLIHSEQL--Q-----------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   ---------------------------------KLDP-----------------------
8975_Tthe_CAMKK-Unclassified   ---------------------------------F--F-----------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ---------------------------------E--R-----------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ---------------------------------Q--S-----------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        NESRC-TD-------------H---Q----------------------------------
CAMKK2_Mmus_CAMKK-Meta         GGS---RE-------------G---Q----------------------------------
CAMKK1_Mmus_CAMKK-Meta         NVAHL-EEADE----------G---P----------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  GTS-S-SVS------------L---R----------------------------------
ELM1_Scer_ELM                  ------RE-D--------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         DVTHL-EEADG----------G---P----------------------------------
CaMKK2_Hsap_CAMKK-Meta         GSS-S-SE-------------S---Q----------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               -TSNI----SQIPDFTKYCI----------------------------------------
DDB0220010_Ddis_CAMKK-Meta     GED-Y--E-CE----------N---K----------------------------------
19056_Tthe_CAMKK-Unclassified  SRNNSSNPSQ------------EEI----------------QLSYIQQNRRMFQRSG---
21621_Tthe_CAMKK-Unclassified  ANSNS-EESE------------ESF---DQNNDYVVEYDDKQ-----------FQGQ-GF
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  GNKQN-SNNS------------QEF---DSPFGQ----------------------QRNN
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   NSTNI-QQAEPSPKSTFNNSQAVDQE----------------------------------
8975_Tthe_CAMKK-Unclassified   G----------------------GV-----------------------------------
8976_Tthe_CAMKK-Unclassified   -----------------------DL-----------------------------------
CAMKK_Spur_CAMKK-Meta          GER-E-KERER----------EKEREKER-------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       GGK-K-DGE------------S---K----------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ---------------------------------------------------------LQC
CAMKK2_Mmus_CAMKK-Meta         ---------------------------------------------------------KPC
CAMKK1_Mmus_CAMKK-Meta         ---------------------------------------------------------EPA
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ---------------------------------------------------------SPT
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ---------------------------------------------------------EPT
CaMKK2_Hsap_CAMKK-Meta         ---------------------------------------------------------KPC
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ---------------------------------------------------------KNL
19056_Tthe_CAMKK-Unclassified  ----AINI-----------------------------------------------Q-TPS
21621_Tthe_CAMKK-Unclassified  GNKN--------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  DSENKIDIQNLNSNNNSIQNSVGRDHLNSPSLANQTANFFKNGENDNFSSREYNNS-SPQ
2641_Tthe_CAMKK-Unclassified   -------------------------------------------------------Q-SPS
5409_Tthe_CAMKK-Unclassified   -------------------------------------------------------Q-DPQ
5517_Tthe_CAMKK-Unclassified   ---------------------------------------------------------KNI
8975_Tthe_CAMKK-Unclassified   -------------------------------------------------------HHHHD
8976_Tthe_CAMKK-Unclassified   --------------------------------------------------------EHHG
CAMKK_Spur_CAMKK-Meta          --ER----------------------------------------------------ERER
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ---------------------------------------------------------TET
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------EN----------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------EA----------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------R-----------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------K-----------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------R-----------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------EA----------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------NL----------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------RNSNSG-----------------------VAVRQSRFCKT--------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------IFSNNII-----------------------PETANKNIIERQNNRTPTLSKPSS
2641_Tthe_CAMKK-Unclassified   ------KQGN--------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------KDIKKRIGKPTPIDTSVGMLQQQDQLNQNN------------------------
5517_Tthe_CAMKK-Unclassified   DQQRNNK-----------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------DDLD--------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------QDVD--------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------EG----------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------G-----------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        --------------------NIVG------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ---------------------LRG------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ----------------------NG------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  -----------------------E------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ----------------------NG------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ---------------------LRG------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ---------------------ISY------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------IRNLQGLG----------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  LINPTFSNDYILVGGIATEQNISGLGNGIIVNHSNQYGKQLSQISEEKEMSLLTNHIRRT
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ---------------------VRE------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ---------------------------------QVYSSEQS-------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  NQKKSSIKVDNDSNNSQSDNNLVQGNATSRGSANITTADQT-------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   -------------------------------------LNESKKQDGLKREDNQDIKQE--
5517_Tthe_CAMKK-Unclassified   ---------------------------------------------------------QQK
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   VFYDASPTQAQKLEDQVPIYINGDLHKVYSTQKSIKLKDNAQLIINQPSINDTNQKIEKQ
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ---------------------------------------------------------LSL
CAMKK2_Mmus_CAMKK-Meta         ---------------------------------------------------------LSS
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  -----------------------------------------------------------S
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ---------------------------------------------------------LSS
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------GPVN--------------------------------
DDB0220010_Ddis_CAMKK-Meta     ---------------------------------------------------------IRN
19056_Tthe_CAMKK-Unclassified  ----------------------------------------------QEQLL-QILN--AK
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ----------------------------------------------SPQNC-QGLNG---
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ----------------------------------------------EKNVN-DGISLTTP
5517_Tthe_CAMKK-Unclassified   TESSIQNKQQENIKQASPVTTVNVQIKPREKSSTIQSNQVFSNKSETPQSLDQILN----
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ---------------------------------------------------------MWT
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       -----------------------------------------------------------S
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        -ETQIA------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         LSIHLG------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  SATNL-------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         LSIHLG------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     L--LFG------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ---------------------------------------------------TIINAIGNY
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   LNAQAAIKQIFIIPPYDSEGNLQEEI---------------KTLEIKADVQS--------
5517_Tthe_CAMKK-Unclassified   ---------------------------------------RNR------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          LPIIVATILQTLLPPEPGRNLLLKAADACMWPAWVPVLKRRR------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       FRTHV-------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  NNNAFNNQNNILQKEITCNQNNQINANTNKAACAKEQQNDVVFNENNTIQISTQINNKSN
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        -------------------------------------E----------------------
CAMKK2_Mmus_CAMKK-Meta         -------------------------------------M----------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         -------------------------------------M----------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     -------------------------------------N----------------------
19056_Tthe_CAMKK-Unclassified  ------------------KSQ-------------------R-------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  NLNKEENDQNEEKINKTQS-----------------------------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------QLK-------------------K-------------------
5517_Tthe_CAMKK-Unclassified   --------------------------------------NQTVQESKEYQQYQNTSNSIQV
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          -------------------KGPAYSDQQDEGSCTKMGAGNS-------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------NS----------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------ES----------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------ES----------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------NS----------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------EKILE-------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------------------------------QDPS--------------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------QKIIE-------------------------
5517_Tthe_CAMKK-Unclassified   ASQSDLNLVKYDLLKLVQELKTGDFQLQYDQTLQDKIIGGSGGNFMEGSILDFFSINQPK
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------ATICDKFR----------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   VVNEKKIQELQDQIRCDTDLLALIKQNFNSNHWKKSISLSPQVNKKHSILNGIPLIRKCD
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ---------------------------------------------------------SI-
CAMKK2_Mmus_CAMKK-Meta         ---------------------------------------------------------FI-
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ---------------------------------------------------------FI-
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ---------------------------------------------------------HQ-
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   STNIKDTLEAEESIGIGDDYNLSPISRKQSMQITINTFGDLAISSLAQLEKNQDQVSIIQ
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ---------------------------------------------------------SS-
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ----NVSRELKP----------HDHTFPKDKQTFKQISDELRKSYENINKVQNIKKSQSV
CAMKK2_Mmus_CAMKK-Meta         ----VVT-ECEP----------G-------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------A-GMAEG---------ARDNASIAS-----------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ----VVT-ECEP----------G-------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ----QLYNEIIPT-TTSTTSTTT-------------------------------------
19056_Tthe_CAMKK-Unclassified  --------QNTPL-SSK------------------------------NGRRGSLNIYSKL
21621_Tthe_CAMKK-Unclassified  ----------------------------------------------------NQKIIFNS
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ----------MPL-QQQ------------------------------KS-NGSFRIKKNM
2641_Tthe_CAMKK-Unclassified   --------KVVPL-DEK-------------------------------------------
5409_Tthe_CAMKK-Unclassified   --------AKKK--------------------------------------QSQESEQSNI
5517_Tthe_CAMKK-Unclassified   NSNSDTS-MESPK-TNT-------------------------------------------
8975_Tthe_CAMKK-Unclassified   --------KLDPT-MQT-------------------------------------------
8976_Tthe_CAMKK-Unclassified   --------ENNQFYHQE-------------------------------------------
CAMKK_Spur_CAMKK-Meta          ----SSS-DLSP----------G-------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------I-KVED----------DGQNEVIRE-----------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ENFEK----CSEINLANK------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ----------------RG------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ----------------CA------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ----------------NS------------------------------------------
19056_Tthe_CAMKK-Unclassified  EALGQKNQTLTKLKT---------------------------------------------
21621_Tthe_CAMKK-Unclassified  LQDEH----HSNIKPGIQQ-----------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  NTKSV----SVHTSPNEIIEKSYQKQNSLHKNEILNQNTIRQNNFYNNQHVSSHDFVPIE
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   EKSPLQQIPEQSSQESLSK-----------------------------------------
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ----------------SS------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  QQNNPVMQSRDEQHSNIFFNNTTSPKKQNTINNTPQNYVKNQQLAQRETFRNNQQSIYNH
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  FRQFKQPLKQDSDKLNNINLQDDYQNLQSAGLKQTRKLSRLNPRMSQNITKFVSPKTNLI
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ---------------------------------CL-------------------------
CAMKK2_Mmus_CAMKK-Meta         ---------------------------------VD-------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ---------------------------------VD-------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ---------------------------------VY-------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------QSDLDSNDEEENFEEKVSKYTLYEIAKQSS
21621_Tthe_CAMKK-Unclassified  ---------------------------------I--------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  EFVQQMQYKSQRNSSVSLQSPFLFQSQFQPQNYY--------------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------DIQLQQQSSDQVDKQKIQKKSQFEQSKQQE
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ---------------------------------VD-------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ----------------------------Y-------------T----NL-----N-----
CAMKK2_Mmus_CAMKK-Meta         ----------------------------L-------------N---LAR-----D-----
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------V-----D-----
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------S-----S-----
ELM1_Scer_ELM                  ------------------------------------------------L-----D-----
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------V-----D-----
CaMKK2_Hsap_CAMKK-Meta         ----------------------------L-------------G---LAR-----D-----
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ----------------------------Q-------------N---IGL-----DGYNNN
19056_Tthe_CAMKK-Unclassified  IQELDEDTFQKNQHSVFAVPSHQQFIQDQ-------------NLEVPEE-----DSSDED
21621_Tthe_CAMKK-Unclassified  ---------------------------NY-------------G-----------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ---------------------------DQ-------------NMEI--------DG----
2641_Tthe_CAMKK-Unclassified   ----------------------------------------------PAI-----------
5409_Tthe_CAMKK-Unclassified   T---EIKQTMSDQKNSQSGPSQEQTVQSNTIETNSLKNQESNKIQ--QT-----KKTPES
5517_Tthe_CAMKK-Unclassified   ----------------------------------------------QQFDSNQNQ-----
8975_Tthe_CAMKK-Unclassified   ----------------------------------------------STI-----------
8976_Tthe_CAMKK-Unclassified   ----------------------------------------------HNI-----------
CAMKK_Spur_CAMKK-Meta          ----------------------------Q-------------H---PAT-----D-----
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------T-----E-----
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     NNNNNNNN------------------NNNNI-----------------------------
19056_Tthe_CAMKK-Unclassified  ANDQEQQL------------------NNSKV-----------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  LSPISS-----------------------NVNPNFRGGYDYDVEDEEVARQMENDKSNMN
2641_Tthe_CAMKK-Unclassified   -----------------------------SV-----------------------------
5409_Tthe_CAMKK-Unclassified   I---PNKIEQTIRANNDENKESKADQTTSQI-----------------------------
5517_Tthe_CAMKK-Unclassified   ------QF------------------SNEEI-----------------------------
8975_Tthe_CAMKK-Unclassified   -----------------------------SR-----------------------------
8976_Tthe_CAMKK-Unclassified   -----------------------------SL-----------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  IASMTNFQNSNNSSSYEEQRGAYSPYSKEQSQTISVLPSIINGSEFCDNSKIDFDKYDIE
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ------------------------------------------------------------
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ----------------------------------MNNYGYDDYGYSYEEDEDYYDEMPIP
19056_Tthe_CAMKK-Unclassified  ----------------------------------N-------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  YIDGYDGVYKGQNNLLSSKLQHSQILNSQLFSQQN-------------------------
2641_Tthe_CAMKK-Unclassified   ----------------------------------S-------------------------
5409_Tthe_CAMKK-Unclassified   ----------------------------------N-------------------------
5517_Tthe_CAMKK-Unclassified   ----------------------------------QN------------------------
8975_Tthe_CAMKK-Unclassified   ----------------------------------S-------------------------
8976_Tthe_CAMKK-Unclassified   ----------------------------------E-------------------------
CAMKK_Spur_CAMKK-Meta          ------------------------------------------------------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ---------------TSPKERNA-------------------------LDKQAMF-----
CAMKK2_Mmus_CAMKK-Meta         ---------------QPPEADG-----------------------------QEL------
CAMKK1_Mmus_CAMKK-Meta         ---------------PPPRARAA----------------------------SVI------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------------------------------------V-----------
ELM1_Scer_ELM                  ---------------SPP------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ---------------PPPRARAA----------------------------SVI------
CaMKK2_Hsap_CAMKK-Meta         ---------------RPLEADG-----------------------------QEV------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     TIVAQPQPQPQPQPQPQPQPQQ-----------------------------PIR------
19056_Tthe_CAMKK-Unclassified  ------------NLPP-PSQLKSN-------------------------YHQRV------
21621_Tthe_CAMKK-Unclassified  ------------QIEQ---------SN--------------------KIRNYSI------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------------VVLP---------SS--------------------IANSQSV------
2641_Tthe_CAMKK-Unclassified   ------------KEDP-QTNCNNNVTQ--------------------NTHNQEI------
5409_Tthe_CAMKK-Unclassified   ------------Q-VP-TVQTS-------------------------QHNGQKL------
5517_Tthe_CAMKK-Unclassified   -------------NKEIR------LIQKRQSSSVRFMLPNNNLEKIKESDEKEE------
8975_Tthe_CAMKK-Unclassified   ------------KR----------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------KYS---------------------------------------------
CAMKK_Spur_CAMKK-Meta          ---------------KS-NGNG-----------------------------KKVLSEGQI
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------------------------------------------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        -----------------------------------------------IKFHSLELCTDKV
CAMKK2_Mmus_CAMKK-Meta         ------------------------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ------------------------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  -----------------------------DSLNM--LLERQRVRQLNH------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------------------------------------------------
CaMKK2_Hsap_CAMKK-Meta         ------------------------------------------------------------
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------------------------------------------------
19056_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
21621_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
2641_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5409_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
5517_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
CAMKK_Spur_CAMKK-Meta          SFGVAPKSFGGKQQHTAGRRENGDGMDTGDASHVALLSD--HTKSTQE------------
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ----------------------------------------RRLRESHA------------
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        CSLHIHENFCTDIHKCVVDS-------E--------------------SNK--------P
CAMKK2_Mmus_CAMKK-Meta         ------------------PL-------E--------------------ASD--------P
CAMKK1_Mmus_CAMKK-Meta         ------------------PG-------S--------------------ASR--------P
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  ------------------PQ----------------------------------------
ELM1_Scer_ELM                  ------------------------------------------------------------
CaMKK1_Hsap_CAMKK-Meta         ------------------PG-------S--------------------TSR--------L
CaMKK2_Hsap_CAMKK-Meta         ------------------PL-------D--------------------TSG--------S
TOS3_Scer_ELM                  ------------------------------------------------------------
YGL059W_Scer_ELM               ------------------------------------------------------------
DDB0220010_Ddis_CAMKK-Meta     ------------------IV-------S--------------------QNQ--------Q
19056_Tthe_CAMKK-Unclassified  ------------------KS-------M--------------------MSG--------T
21621_Tthe_CAMKK-Unclassified  ------------------GV----------------------------TNS--------S
22526_Tthe_CAMKK-Unclassified  ------------------------------------------------------------
24780_Tthe_CAMKK-Unclassified  ------------------YQ----------------------------NSK--------T
2641_Tthe_CAMKK-Unclassified   ------------------KK-------E--------------------QQD--------D
5409_Tthe_CAMKK-Unclassified   ------------------TNQNKQSQQQ--------------------ISGVNQQINNQS
5517_Tthe_CAMKK-Unclassified   ------------------DM-------N--------------------TKT---------
8975_Tthe_CAMKK-Unclassified   ------------------------------------------------------------
8976_Tthe_CAMKK-Unclassified   ---------------------------D--------------------LCD--------E
CAMKK_Spur_CAMKK-Meta          -----EDE----------KM-------DTMESEPKVIFTAGDADDDDDDLS--------P
CC1G_14171_Ccin_ELM            ------------------------------------------------------------
CC1G_07875_Ccin_ELM            ------------------------------------------------------------
AqueK153_Aque_CAMKK-Meta       ------------------PS-------S--------------------NSY--------E
GK045_Glam_CAMKK-Unclassified  ------------------------------------------------------------


CG17698_Dmel_CAMKK-Meta        ---N--KMKK------------------------------------------CLD-----
CAMKK2_Mmus_CAMKK-Meta         ------ESRS---P----------------------------------------------
CAMKK1_Mmus_CAMKK-Meta         ---T--PVRP---S----------------------------------------------
ckk-1_Cele_CAMKK-Meta          ------------------------------------------------------------
PAK1_Scer_ELM                  -HQQ---------HI---------------------------------------------
ELM1_Scer_ELM                  -------ITP---T--------------------------------------------</