Protein (view, download) , Domain (view, download)
22258_Tthe                        MGCTS-AKG-TGK-----------------------------------------------
25228_Tthe                        MAEQG-G--VYL------------------------------------------------
7380_Tthe                         MGCVK-SH-STQV-----------------------------------------------
23071_Tthe                        MSQQI-IQS-EQK-----------------------------------------------
10025_Tthe                        MGCCQ-SDE-RDF-----------------------------------------------
11744_Tthe                        MGTNL-KKS-DQN-----------------------------------------------
12974_Tthe                        MEKDS-KQGALV------------------------------------------------
16214_Tthe                        MSELV-FKL-IRK--DNQSYQCKVFRNLEQNDLESFIKGFKCSIYVKDQLIEVQDFKGIQ
18013_Tthe                        MDKNS-D--IFV------------------------------------------------
19206_Tthe                        MGACS-NKP-QRK-----------------------------------------------
19915_Tthe                        MGCCQ-SQD-QEH-----------------------------------------------
2016_Tthe                         MATQP-LKE-MLV-----------------------------------------------
22011_Tthe                        MGCTS-SNQ-VQN-----------------------------------------------
22014_Tthe                        MGCGN-SQV-RDI-----------------------------------------------
22015_Tthe                        MGCGQ-SQL-NNT-----------------------------------------------
24111_Tthe                        MADIN-K--VVV------------------------------------------------
2675_Tthe                         MGQCA-SKQ-PDS-----------------------------------------------
28485_Tthe                        MGCTN-SQD-KLV-----------------------------------------------
4576_Tthe                         MNPLM-SP-CMI------------------------------------------------
5812_Tthe                         MGNKD-FNV-NSV-----------------------------------------------
7382_Tthe                         MGCGQ-SL-NQVK-----------------------------------------------
7386_Tthe                         MGGCA-KSRNQIA-----------------------------------------------
8052_Tthe                         MGQKG-SKQ-NKE-----------------------------------------------
10195_Tthe_Ciliate-E2a            MSDII-SGD-TQN-----------------------------------------------
2623_Tthe_Ciliate-E2a             MGCTT-SKS-SKS-----------------------------------------------
n1172_Tthe                        MCKVN-FCS-IRS-----------------------------------------------
CDPK-Un_a_Smoe_CDPK-Unclassified  MGNCV-RCV-NSLSCV--------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  MGNCV-RCV-NSLSCV--------------------------------------------
CDPKa_b-2_Smoe_CDPKa              MGNACIGST-TNS-----------------------------------------------
CDPKa_b-1_Smoe_CDPKa              MGNACIGST-TNS-----------------------------------------------
CDPKa_a-1_Smoe_CDPKa              MGNSCIGSG-SLA-----------------------------------------------
CDPKa_a-2_Smoe_CDPKa              MGNSCIGSG-SLA-----------------------------------------------
CDPKb_b-2_Smoe_CDPKb              MGNCL-GGG-DEK-----------------------------------------------
CDPKb_c_Smoe_CDPKb                MGNKQ-GRN-DPS-----------------------------------------------
CDPKb_a_Smoe_CDPKb                MGNCL-GHG-SRE-----------------------------------------------
CDPKb_b-1_Smoe_CDPKb              MGNCL-GGG-DEK-----------------------------------------------
CDPKd_b_Smoe_CDPKd                MGNCC-ATP-GIK-----------------------------------------------
CDPKd_a-2_Smoe_CDPKd              MGNCC-ATP-PRE-----------------------------------------------
CDPKd_a-1_Smoe_CDPKd              MGNCC-ATP-PRE-----------------------------------------------
CDPKe_a-2_Smoe_CDPKe              MGVCF-SVP-KRR-----------------------------------------------
CDPKe_a-1_Smoe_CDPKe              MGVCF-SVP-KRR-----------------------------------------------
CDPKe_d_Smoe_CDPKe                MGICF-SAD-KSE-----------------------------------------------
CDPKf_a-1_Smoe_CDPKf              MGQCY-GKT-GGN-----------------------------------------------
CDPKf_a-2_Smoe_CDPKf              MGQCY-GKT-GGN-----------------------------------------------
CDPKf_b_Smoe_CDPKf                MGQCY-GKV-AVT-----------------------------------------------
                                  *

22258_Tthe                        -------------------SK---------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         -------------------DD---------------------------------------
23071_Tthe                        -------------------ET---------------------------------------
10025_Tthe                        -------------------NI---------------------------------------
11744_Tthe                        -------------------NQ---------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        SSRLGIIMKGKVKIQSSNNGKKKQYHENKMVLRPGDKIGAESMLLEKANLFSLIVETEEL
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        -------------------TK---------------------------------------
19915_Tthe                        -------------------EK---------------------------------------
2016_Tthe                         -------------------SE---------------------------------------
22011_Tthe                        -------------------AQ---------------------------------------
22014_Tthe                        -------------------ER---------------------------------------
22015_Tthe                        -------------------CQ---------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         -------------------PT---------------------------------------
28485_Tthe                        -------------------NG---------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         -------------------QG---------------------------------------
7382_Tthe                         -------------------ND---------------------------------------
7386_Tthe                         -------------------DD---------------------------------------
8052_Tthe                         --------------------K---------------------------------------
10195_Tthe_Ciliate-E2a            -------------------VK---------------------------------------
2623_Tthe_Ciliate-E2a             -------------------NS---------------------------------------
n1172_Tthe                        -------------------KK---------------------------------------
CDPK-Un_a_Smoe_CDPK-Unclassified  -------------------NR---------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  -------------------NR---------------------------------------
CDPKa_b-2_Smoe_CDPKa              -------------------KN---------------------------------------
CDPKa_b-1_Smoe_CDPKa              -------------------KN---------------------------------------
CDPKa_a-1_Smoe_CDPKa              -------------------GR---------------------------------------
CDPKa_a-2_Smoe_CDPKa              -------------------GR---------------------------------------
CDPKb_b-2_Smoe_CDPKb              -------------------KQ---------------------------------------
CDPKb_c_Smoe_CDPKb                -------------------SG---------------------------------------
CDPKb_a_Smoe_CDPKb                -------------------NI---------------------------------------
CDPKb_b-1_Smoe_CDPKb              -------------------KQ---------------------------------------
CDPKd_b_Smoe_CDPKd                -------------------RK---------------------------------------
CDPKd_a-2_Smoe_CDPKd              -------------------AG---------------------------------------
CDPKd_a-1_Smoe_CDPKd              -------------------AG---------------------------------------
CDPKe_a-2_Smoe_CDPKe              -------------------KQ---------------------------------------
CDPKe_a-1_Smoe_CDPKe              -------------------KQ---------------------------------------
CDPKe_d_Smoe_CDPKe                -------------------KA---------------------------------------
CDPKf_a-1_Smoe_CDPKf              -------------------EQ---------------------------------------
CDPKf_a-2_Smoe_CDPKf              -------------------EQ---------------------------------------
CDPKf_b_Smoe_CDPKf                -------------------ED---------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        VLLEIEKYFFDRCIRQLESERLESNIAFLKSTQLFKHITNDSILTMILYNSVKISFQNNE
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        ------------------------------------------------------------
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        VVYSQDQASYAIYIVLHGKFQVQQRFQDDTDQFMDQVSICSDNQEGTPNLRKQQSLDQSS
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        ------------------------------------------------------------
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        FFSNTTTLKIRTVETYEIFGEEEIMDMRQRNSTVVCLQDCSEVLVIRPVIYKSCILKDDA
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        ------------------------------------------------------------
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        -----------------Q------------E-----------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         -----------------Q------------K-----------------------------
23071_Tthe                        -----------------E------------V-----------------------------
10025_Tthe                        -----------------I------------T-----------------------------
11744_Tthe                        -----------------Q------------T-----------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        VKKKLVELIGQKQQEAKK------------K-----------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        -----------------Y------------K-----------------------------
19915_Tthe                        -----------------N------------I-----------------------------
2016_Tthe                         -----------------K------------------------------------------
22011_Tthe                        -----------------K------------I-----------------------------
22014_Tthe                        -----------------K------------Q-----------------------------
22015_Tthe                        -----------------P------------R-----------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         -----------------R------------E-----------------------------
28485_Tthe                        -----------------E------------Q-----------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         -----------------S------------------------------------------
7382_Tthe                         -----------------G------------Q-----------------------------
7386_Tthe                         -----------------V------------L-----------------------------
8052_Tthe                         -----------------K------------A-----------------------------
10195_Tthe_Ciliate-E2a            -----------------L------------V-----------------------------
2623_Tthe_Ciliate-E2a             -----------------N------------G-----------------------------
n1172_Tthe                        ------------------------------KYLKIFITLSSKLFLGIAILWINIKFLKAA
CDPK-Un_a_Smoe_CDPK-Unclassified  -----------------GAK-----LVPSEA-----------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  -----------------GAK-----LVPSEA-----------------------------
CDPKa_b-2_Smoe_CDPKa              -----------------G------------------------------------------
CDPKa_b-1_Smoe_CDPKa              -----------------G------------------------------------------
CDPKa_a-1_Smoe_CDPKa              -----------------SWLFFQGGWIAQER-----------------------------
CDPKa_a-2_Smoe_CDPKa              -----------------SWLFFQGGWIAQER-----------------------------
CDPKb_b-2_Smoe_CDPKb              -----------------S------------A-----------------------------
CDPKb_c_Smoe_CDPKb                -----------------G------------Q-----------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------H-----------------------------
CDPKb_b-1_Smoe_CDPKb              -----------------S------------A-----------------------------
CDPKd_b_Smoe_CDPKd                -----------------E------------R-----------------------------
CDPKd_a-2_Smoe_CDPKd              -----------------D------------Q-----------------------------
CDPKd_a-1_Smoe_CDPKd              -----------------D------------Q-----------------------------
CDPKe_a-2_Smoe_CDPKe              -----------------D------------P-----------------------------
CDPKe_a-1_Smoe_CDPKe              -----------------D------------P-----------------------------
CDPKe_d_Smoe_CDPKe                -----------------E------------K-----------------------------
CDPKf_a-1_Smoe_CDPKf              -----------------Q------------H-----------------------------
CDPKf_a-2_Smoe_CDPKf              -----------------Q------------H-----------------------------
CDPKf_b_Smoe_CDPKf                -----------------S------------K-----------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        NYPQLVFSPSSLQQYDLRSQGGYSAKLAYAQNASLVFAATGSLGVSVLDSKTYQIISQIN
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        LNNQTITGLDVTSDGEYVMMGYQNKFSVFKYSNKNLTLLSQASFQSGVIMDVSLDQTETI
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        -----------N------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         -----------L------------------------------------------------
23071_Tthe                        -----------F------------------------------------------------
10025_Tthe                        -----------D------------------------------------------------
11744_Tthe                        -----------Q------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        -----------P------------------------------------------------
19915_Tthe                        -----------E------------------------------------------------
2016_Tthe                         -----------Q------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        -----------I------------------------------------------------
22015_Tthe                        -----------D------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         -----------D------------------------------------------------
28485_Tthe                        -----------P------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         -----------S------------------------------------------------
7382_Tthe                         -----------M------------------------------------------------
7386_Tthe                         -----------L------------------------------------------------
8052_Tthe                         -----------R------------------------------------------------
10195_Tthe_Ciliate-E2a            -----------K------------------------------------------------
2623_Tthe_Ciliate-E2a             -----------E------------------------------------------------
n1172_Tthe                        AFGYGMPGQICAYNILNKNNIVFLTKFNTASNRVRQLYATLDNKYLLLADSTSGLNVIQV
CDPK-Un_a_Smoe_CDPK-Unclassified  -----------E------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  -----------E------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              -----------D------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              -----------D------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              -----------R------------------------------------------------
CDPKb_c_Smoe_CDPKb                -----------Q------------------------------------------------
CDPKb_a_Smoe_CDPKb                -----------H------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              -----------R------------------------------------------------
CDPKd_b_Smoe_CDPKd                -----------K------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              -----------D------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              -----------D------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              -----------A------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              -----------A------------------------------------------------
CDPKe_d_Smoe_CDPKe                -----------E------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              -----------K------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              -----------K------------------------------------------------
CDPKf_b_Smoe_CDPKf                -----------P------------------------------------------------


22258_Tthe                        GD------------------IAA-NK----------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         TI----------------------------------------------------------
23071_Tthe                        SK--------------------N-AN----------------------------------
10025_Tthe                        YQ--------------------Q--N----------------------------------
11744_Tthe                        QKSKVSTPRSKKTPKPIQSQ----------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        -E--------------------K-Q-----------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        NT----------------------------------------------------------
19915_Tthe                        DK----IHEGKVISQDN--DREQ--N-------SDT------------------------
2016_Tthe                         IP--------------------S-T-----------------------------------
22011_Tthe                        -Q--------------------S-S-----------------------------------
22014_Tthe                        SD--------------------E-KT----------------------------------
22015_Tthe                        LK--------------------D-ND----------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ISQPQ-MPGGFQFPDESG-HQQESQE----------------------------------
28485_Tthe                        S-----------------------KK----------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         KN----------MHNDKEKPREE--E-------STRQLKEKYGKSIVSHNSKQDYQDGDD
7382_Tthe                         TE----------------------------------------------------------
7386_Tthe                         SK----------------------------------------------------------
8052_Tthe                         IE-----------------------Q----------------------------------
10195_Tthe_Ciliate-E2a            TN---------------------CSQ----------------------------------
2623_Tthe_Ciliate-E2a             KG----------------------------------------------------------
n1172_Tthe                        TN--------------------S-QG----------------------------------
CDPK-Un_a_Smoe_CDPK-Unclassified  RN--------------------R-RNAPPPPPPR--------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  RN--------------------R-RNAPPPPPPR--------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              KI--------------------A-QG----------------------------------
CDPKa_a-2_Smoe_CDPKa              KI--------------------A-QG----------------------------------
CDPKb_b-2_Smoe_CDPKb              Q-----------------------------------------------------------
CDPKb_c_Smoe_CDPKb                EW--------------------P-QN----------------------------------
CDPKb_a_Smoe_CDPKb                HR--------------------R-DD----------------------------------
CDPKb_b-1_Smoe_CDPKb              Q-----------------------------------------------------------
CDPKd_b_Smoe_CDPKd                P-----------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              S-----------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              S-----------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              TG--------------------N-------------------------------------
CDPKe_a-1_Smoe_CDPKe              TG--------------------N-------------------------------------
CDPKe_d_Smoe_CDPKe                KN--------------------K-KH----------------------------------
CDPKf_a-1_Smoe_CDPKf              ST--------------------E-EN----------------------------------
CDPKf_a-2_Smoe_CDPKf              ST--------------------E-EN----------------------------------
CDPKf_b_Smoe_CDPKf                EE--------------------K-EA----------------------------------


22258_Tthe                        --------------------------------------------Y---------VQ-E--
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         --------------------------------------------L---------E-----
23071_Tthe                        --------------------------------------------E-E-------SD-H--
10025_Tthe                        --------------------------------------------Y-S-------MR-S--
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------G-----
19915_Tthe                        -----------YE-----------------------------KDY-E-------KN-Q--
2016_Tthe                         ---------------------------------------------------------K--
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        --------------------------------------------A-Q-------TQ-A--
22015_Tthe                        --------------------------------------------I-G-------NNYK--
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         --------------------------------------------N-G-------QE-Q--
28485_Tthe                        --------------------------------------------N---------TK-D--
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         RLVGSQTNNVAYEEQVSNHDKAIDKQASHQYGSSQREIQQGKEE--A-------QK-Q--
7382_Tthe                         --------------------------------------------A---------E-----
7386_Tthe                         --------------------------------------------H---------E-----
8052_Tthe                         --------------------------------------------T---------LK-E--
10195_Tthe_Ciliate-E2a            --------------------------------------------N---------EEYQ--
2623_Tthe_Ciliate-E2a             ----------------------------------------------Q-------SN-Q--
n1172_Tthe                        --------------------------------------------N-Y-------QL-KSI
CDPK-Un_a_Smoe_CDPK-Unclassified  --------------------------------------------NRQQPQRSAQEQ-QQ-
CDPK-Un_b_Smoe_CDPK-Unclassified  --------------------------------------------NRQQPQRSAQEQ-QQ-
CDPKa_b-2_Smoe_CDPKa              -----------------------------------------------------FFH-RS-
CDPKa_b-1_Smoe_CDPKa              -----------------------------------------------------FFH-RS-
CDPKa_a-1_Smoe_CDPKa              --------------------------------------------SWEEPG---GSK-QS-
CDPKa_a-2_Smoe_CDPKa              --------------------------------------------SWEEPG---GSK-QS-
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                --------------------------------------------Q-DRPR--------E-
CDPKb_a_Smoe_CDPKb                --------------------------------------------K-NNAY--DFPP-KA-
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ----------------------------------------------N-P----FAQ-DG-
CDPKd_a-2_Smoe_CDPKd              ----------------------------------------------HKPR---GKK-KR-
CDPKd_a-1_Smoe_CDPKd              ----------------------------------------------HKPR---GKK-KR-
CDPKe_a-2_Smoe_CDPKe              -------------------------------------------------A---KSR-V--
CDPKe_a-1_Smoe_CDPKe              -------------------------------------------------A---KSR-V--
CDPKe_d_Smoe_CDPKe                --------------------------------------------G-DHAA---KDQ-V--
CDPKf_a-1_Smoe_CDPKf              --------------------------------------------S-YNGY---STT-TG-
CDPKf_a-2_Smoe_CDPKf              --------------------------------------------S-YNGY---STT-TG-
CDPKf_b_Smoe_CDPKf                --------------------------------------------S-YARQ---DSR-Q--


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        AVGTPAWDVMDVKFTNDYQIAYVADFFYGLFYINLGFVFNSDPSAYPLQSVNSLAITSNN
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        NYLLVGQRGLGIKIIDISDKNNPAYYSDIPAVGHAFTILLVNNEQNIFFANSISIIVYGQ
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        SVLNLNDQYPNLYNGFQSFMYSPSKTLYYWKCIIGKNDTYFYGVFDDGGVYIMTYGDDPY
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        NMQILAYIMYNPTDQTDFMWINEDETLMILGISTNQYTLEVFDITDKTKPKLITQITKTE
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-1_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_a-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKb_b-2_Smoe_CDPKb              ------------------------------------------------------------
CDPKb_c_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_a_Smoe_CDPKb                ------------------------------------------------------------
CDPKb_b-1_Smoe_CDPKb              ------------------------------------------------------------
CDPKd_b_Smoe_CDPKd                ------------------------------------------------------------
CDPKd_a-2_Smoe_CDPKd              ------------------------------------------------------------
CDPKd_a-1_Smoe_CDPKd              ------------------------------------------------------------
CDPKe_a-2_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_a-1_Smoe_CDPKe              ------------------------------------------------------------
CDPKe_d_Smoe_CDPKe                ------------------------------------------------------------
CDPKf_a-1_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_a-2_Smoe_CDPKf              ------------------------------------------------------------
CDPKf_b_Smoe_CDPKf                ------------------------------------------------------------


22258_Tthe                        ------------------------------------------------------------
25228_Tthe                        ------------------------------------------------------------
7380_Tthe                         ------------------------------------------------------------
23071_Tthe                        ------------------------------------------------------------
10025_Tthe                        ------------------------------------------------------------
11744_Tthe                        ------------------------------------------------------------
12974_Tthe                        ------------------------------------------------------------
16214_Tthe                        ------------------------------------------------------------
18013_Tthe                        ------------------------------------------------------------
19206_Tthe                        ------------------------------------------------------------
19915_Tthe                        ------------------------------------------------------------
2016_Tthe                         ------------------------------------------------------------
22011_Tthe                        ------------------------------------------------------------
22014_Tthe                        ------------------------------------------------------------
22015_Tthe                        ------------------------------------------------------------
24111_Tthe                        ------------------------------------------------------------
2675_Tthe                         ------------------------------------------------------------
28485_Tthe                        ------------------------------------------------------------
4576_Tthe                         ------------------------------------------------------------
5812_Tthe                         ------------------------------------------------------------
7382_Tthe                         ------------------------------------------------------------
7386_Tthe                         ------------------------------------------------------------
8052_Tthe                         ------------------------------------------------------------
10195_Tthe_Ciliate-E2a            ------------------------------------------------------------
2623_Tthe_Ciliate-E2a             ------------------------------------------------------------
n1172_Tthe                        SNDTDGCVFTKDMTRFICANGGDGIFITDTTDIKNLKIIFTWPLESFMTGTVKDVVIKGA
CDPK-Un_a_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPK-Un_b_Smoe_CDPK-Unclassified  ------------------------------------------------------------
CDPKa_b-2_Smoe_CDPKa              ------------------------------------------------------------
CDPKa_b-1_Smoe_CDPKa              ------------------------------