Protein (view, download) , Domain (view, download)
Eph_Dmel        MK-MVGC-HPNDK-K---------------------------------------------
EphB6_Mmus      MA-TEGT-TGSG------------------------------------------------
EphB4_Mmus      ME-LRA------------------------------------------------------
EphB3_Mmus      MA-GARP-PP--------------------------------------------------
EphB2_Mmus      MA-VRR------------------------------------------------------
EphB1_Mmus      MA-LDC------------------------------------------------------
EphA8_Mmus      MA-PARA-R---------------------------------------------------
EphA7_Mmus      MV-VQTR-FP--------------------------------------------------
EPHA6_Mmus      MQ-FPSP-PAARS-SPAAQAASSPQAAAPAPGQPGPSCPAHRASRGGRPGTSPADRVEEE
EphA5_Mmus      MR-GSGP-RGAGHRRTQGRGGGDDTPRVPAS-----------------------------
EphA4_Mmus      MA-GIFY-----------------------------------------------------
EphA3_Mmus      MD-CHLS-----------------------------------------------------
EphA2_Mmus      ME-LRAV-G---------------------------------------------------
EphA10_Mmus     ME-TGAG-PHP-------------------------------------------------
EphA1_Mmus      ME-RRWP-L---------------------------------------------------
EphB6_Hsap      MA-TEGA-AQLG------------------------------------------------
EphB4_Hsap      ME-LRV------------------------------------------------------
EphB3_Hsap      MA-RARP-PPPPS-PP--------------------------------------------
EphB2_Hsap      MA-LRR------------------------------------------------------
EphB1_Hsap      MA-LDY------------------------------------------------------
EphA8_Hsap      MA-PARG-R---------------------------------------------------
EphA7_Hsap      MV-FQTR-YP--------------------------------------------------
EphA6_Hsap      MQ-FPSP-PAARS-SPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEE-
EphA5_Hsap      MR-GSGP-RGAGRRRPP-SGG-GDTPITPAS-----------------------------
EphA4_Hsap      MA-GIFY-----------------------------------------------------
EphA3_Hsap      MD-CQLS-----------------------------------------------------
EphA2_Hsap      ME-LQAA-R---------------------------------------------------
EphA10_Hsap     ME-TCAG-PHP-------------------------------------------------
EphA1_Hsap      ME-RRWP-L---------------------------------------------------
vab-1_Cele      MR-LYNS-RIL-------------------------------------------------
Eph_Spur        MD-NLR------------------------------------------------------
AqueK267_Aque   MI-YYID-IY--------------------------------------------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   MS-QDLL-TAKA------------------------------------------------
AqueK270_Aque   MY-LSLL-----------------------------------------------------
AqueK271_Aque   MY-FVSP-HPIT------------------------------------------------
AqueK272_Aque   MD-IILS-L---------------------------------------------------
AqueK273_Aque   DNQFSE------------------------------------------------------
AqueK274_Aque   xQ-FSE------------------------------------------------------
AqueK275_Aque   T-----------------------------------------------------------
AqueK276_Aque   MA-HSLS-----------------------------------------------------
AqueK277_Aque   GP-NNY------------------------------------------------------
AqueK278_Aque   MR-RTVR-L---------------------------------------------------
AqueK279_Aque   MC-PSLF-----------------------------------------------------
AqueK280_Aque   MC-LSNS-----------------------------------------------------
AqueK281_Aque   ME-LS-------------------------------------------------------
AqueK282_Aque   MS-SYLL-L---------------------------------------------------
AqueK283_Aque   MS-LWAT-V---------------------------------------------------
AqueK284_Aque   ------------------------------------------------------------
AqueK285_Aque   ------------------------------------------------------------
AqueK286_Aque   MS-TLSS-A---------------------------------------------------
AqueK287_Aque   SD-GKWS-ND--------------------------------------------------
AqueK288_Aque   MS-TSTR-QS--------------------------------------------------
AqueK289_Aque   MT-KLYL-----------------------------------------------------
AqueK290_Aque   ME-LSL------------------------------------------------------
AqueK291_Aque   TQ----------------------------------------------------------
AqueK292_Aque   ML-ALFA-LL--------------------------------------------------
AqueK293_Aque   VL-RLN--I---------------------------------------------------
AqueK294_Aque   E-----------------------------------------------------------
AqueK295_Aque   MS-NGIL-----------------------------------------------------
AqueK296_Aque   MQ-GKRL-----------------------------------------------------
AqueK297_Aque   MM-SALSSA---------------------------------------------------
AqueK298_Aque   ------------------------------------------------------------
AqueK299_Aque   ------------------------------------------------------------
AqueK300_Aque   MD-LSLL-----------------------------------------------------
AqueK301_Aque   ------------------------------------------------------------
AqueK302_Aque   MI----------------------------------------------------------
AqueK303_Aque   MA-SIF------------------------------------------------------
AqueK304_Aque   MK-AITR-KLI-------------------------------------------------
AqueK305_Aque   MA-GSSA-----------------------------------------------------
AqueK306_Aque   MN-XLDH-----------------------------------------------------
AqueK307_Aque   MR-GKWI-LNT-------------------------------------------------
AqueK308_Aque   MF-FLCN-GS--------------------------------------------------
AqueK309_Aque   ME-PSLL-----------------------------------------------------
AqueK310_Aque   MA-AVLK-PA--------------------------------------------------
AqueK311_Aque   MG-WQNY-YP--------------------------------------------------
AqueK312_Aque   MV-YYVK-YFC-------------------------------------------------
AqueK313_Aque   MY-KKRK-WK--------------------------------------------------
AqueK314_Aque   ------------------------------------------------------------
AqueK315_Aque   MI-YRDT-GNQ-------------------------------------------------
AqueK316_Aque   MP-DPFY-YP--------------------------------------------------
AqueK317_Aque   ME-RIEN-EEAE------------------------------------------------
AqueK318_Aque   MS-ATPS-RRSP------------------------------------------------
AqueK319_Aque   MC-HVTM-LVS-------------------------------------------------
AqueK320_Aque   MS-NNES-YI--------------------------------------------------
AqueK321_Aque   MR-TSPV-LW--------------------------------------------------
AqueK322_Aque   MD-QSLV-TYRA------------------------------------------------
AqueK323_Aque   MP-ALSS-A---------------------------------------------------
AqueK324_Aque   KK-EYAV-NFT-------------------------------------------------
AqueK325_Aque   MT-TTPS-TQ--------------------------------------------------
AqueK326_Aque   LL-NEVS-KEEE------------------------------------------------
AqueK327_Aque   MV-LNID-DRA-------------------------------------------------
AqueK328_Aque   MV-LNID-DRA-------------------------------------------------
AqueK329_Aque   MS-SSLF-SP--------------------------------------------------
AqueK330_Aque   MT-HTEX-----------------------------------------------------


Eph_Dmel        ------------------------------------------------VKYDGIKSKTSS
EphB6_Mmus      ------------------------------------------------S-----------
EphB4_Mmus      ------------------------------------------------------------
EphB3_Mmus      -----------------------------------------------GL-----------
EphB2_Mmus      ------------------------------------------------------------
EphB1_Mmus      ------------------------------------------------------------
EphA8_Mmus      ------------------------------------------------------------
EphA7_Mmus      ------------------------------------------------------------
EPHA6_Mmus      EEEEEEEESLVQDPHATRNTWLRCCH-FFLRRRREPTRAMGGCEV-R-E-----------
EphA5_Mmus      ---------------------------------------LAGCYSAP-L-----------
EphA4_Mmus      ------------------------------------------------------------
EphA3_Mmus      ------------------------------------------------------------
EphA2_Mmus      ------------------------------------------------------------
EphA10_Mmus     ------------------------------------------------L-----------
EphA1_Mmus      ------------------------------------------------------------
EphB6_Hsap      ------------------------------------------------N-----------
EphB4_Hsap      ------------------------------------------------------------
EphB3_Hsap      ----------------------------------------------PGL-----------
EphB2_Hsap      ------------------------------------------------------------
EphB1_Hsap      ------------------------------------------------------------
EphA8_Hsap      ------------------------------------------------------------
EphA7_Hsap      ------------------------------------------------------------
EphA6_Hsap      -EEEEEEEDVDKDPHPTQNTCLRCRHFSLRERKREPRRTMGGCEV-R-E-----------
EphA5_Hsap      ---------------------------------------LAGCYSAP-R-----------
EphA4_Hsap      ------------------------------------------------------------
EphA3_Hsap      ------------------------------------------------------------
EphA2_Hsap      ------------------------------------------------------------
EphA10_Hsap     ------------------------------------------------L-----------
EphA1_Hsap      ------------------------------------------------------------
vab-1_Cele      -----------------------------------------------N------------
Eph_Spur        ------------------------------------------------------------
AqueK267_Aque   -----------------------------------------------D------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   ------------------------------------------------------------
AqueK270_Aque   ------------------------------------------------------------
AqueK271_Aque   ------------------------------------------------------------
AqueK272_Aque   ------------------------------------------------------------
AqueK273_Aque   ------------------------------------------------------------
AqueK274_Aque   ------------------------------------------------------------
AqueK275_Aque   ------------------------------------------------------------
AqueK276_Aque   ------------------------------------------------------------
AqueK277_Aque   ------------------------------------------------------------
AqueK278_Aque   ------------------------------------------------------------
AqueK279_Aque   ------------------------------------------------------------
AqueK280_Aque   ------------------------------------------------------------
AqueK281_Aque   ------------------------------------------------------------
AqueK282_Aque   ------------------------------------------------------------
AqueK283_Aque   ------------------------------------------------------------
AqueK284_Aque   ------------------------------------------------------------
AqueK285_Aque   ------------------------------------------------------------
AqueK286_Aque   ------------------------------------------------------------
AqueK287_Aque   ------------------------------------------------------------
AqueK288_Aque   ------------------------------------------------------------
AqueK289_Aque   ------------------------------------------------------------
AqueK290_Aque   ------------------------------------------------------------
AqueK291_Aque   ------------------------------------------------------------
AqueK292_Aque   ------------------------------------------------------------
AqueK293_Aque   ------------------------------------------------------------
AqueK294_Aque   ------------------------------------------------------------
AqueK295_Aque   ------------------------------------------------------------
AqueK296_Aque   ------------------------------------------------------------
AqueK297_Aque   ------------------------------------------------------------
AqueK298_Aque   ------------------------------------------------------------
AqueK299_Aque   ------------------------------------------------------------
AqueK300_Aque   ------------------------------------------------------------
AqueK301_Aque   ------------------------------------------------------------
AqueK302_Aque   ------------------------------------------------------------
AqueK303_Aque   ------------------------------------------------------------
AqueK304_Aque   ------------------------------------------------------------
AqueK305_Aque   ------------------------------------------------------------
AqueK306_Aque   ------------------------------------------------------------
AqueK307_Aque   ------------------------------------------------------------
AqueK308_Aque   ------------------------------------------------------------
AqueK309_Aque   ------------------------------------------------------------
AqueK310_Aque   ------------------------------------------------------------
AqueK311_Aque   ------------------------------------------------------------
AqueK312_Aque   ------------------------------------------------------------
AqueK313_Aque   ------------------------------------------------------------
AqueK314_Aque   ------------------------------------------------------------
AqueK315_Aque   ------------------------------------------------------------
AqueK316_Aque   ------------------------------------------------------------
AqueK317_Aque   ------------------------------------------------------------
AqueK318_Aque   ------------------------------------------------------------
AqueK319_Aque   ------------------------------------------------------------
AqueK320_Aque   ------------------------------------------------------------
AqueK321_Aque   ------------------------------------------------------------
AqueK322_Aque   ------------------------------------------------------------
AqueK323_Aque   ------------------------------------------------------------
AqueK324_Aque   ------------------------------------------------------------
AqueK325_Aque   ------------------------------------------------------------
AqueK326_Aque   ------------------------------------------------------------
AqueK327_Aque   ------------------------------------------------------------
AqueK328_Aque   ------------------------------------------------------------
AqueK329_Aque   ------------------------------------------------------------
AqueK330_Aque   ------------------------------------------------------------


Eph_Dmel        VTILTSVLNDAISALKSAFYKNQAPISEQNRSQIVSRM-SLLRT----------------
EphB6_Mmus      ------------------------------------RVVAGMVC----------------
EphB4_Mmus      ------------------------------------------------------------
EphB3_Mmus      -------------------------------------L-PLLA-----------------
EphB2_Mmus      ------------------------------------------------------------
EphB1_Mmus      ------------------------------------------------------------
EphA8_Mmus      -----------------------------------------LSP----------------
EphA7_Mmus      -------------------------------------S-WIILC----------------
EPHA6_Mmus      -------------------------------------F-LLQFG----------------
EphA5_Mmus      -------------------------------------K-GPLWT----------------
EphA4_Mmus      ---------------------------------------FILFS----------------
EphA3_Mmus      -----------------------------------------I-L----------------
EphA2_Mmus      ----------------------------------------FCLA----------------
EphA10_Mmus     ------------------------------------RL-FVCLI----------------
EphA1_Mmus      ----------------------------------------GLAL----------------
EphB6_Hsap      ------------------------------------R-VAGMVC----------------
EphB4_Hsap      ------------------------------------------------------------
EphB3_Hsap      -------------------------------------L-PLLPP----------------
EphB2_Hsap      ------------------------------------------------------------
EphB1_Hsap      ------------------------------------------------------------
EphA8_Hsap      -----------------------------------------LPP----------------
EphA7_Hsap      -------------------------------------S-WIILC----------------
EphA6_Hsap      -------------------------------------F-LLQFG----------------
EphA5_Hsap      -------------------------------------R-APLWT----------------
EphA4_Hsap      ---------------------------------------FALFS----------------
EphA3_Hsap      -----------------------------------------I-L----------------
EphA2_Hsap      ----------------------------------------ACFA----------------
EphA10_Hsap     ------------------------------------RL-FLCRM----------------
EphA1_Hsap      ----------------------------------------GLGL----------------
vab-1_Cele      ---------------------------------------PHQSI----------------
Eph_Spur        ------------------------------------------NC----------------
AqueK267_Aque   -----------------------------------------P------------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   -------------------------------------------E----------------
AqueK270_Aque   ------------------------------------------------------------
AqueK271_Aque   -------------------------------------------S----------------
AqueK272_Aque   ----------------------------------------LLL-----------------
AqueK273_Aque   ------------------------------------------------------------
AqueK274_Aque   ------------------------------------------------------------
AqueK275_Aque   ------------------------------------------------------------
AqueK276_Aque   ---------------------------------------LSLA-----------------
AqueK277_Aque   ------------------------------------------------------------
AqueK278_Aque   ------------------------------------------------------------
AqueK279_Aque   ---------------------------------------L-L------------------
AqueK280_Aque   ---------------------------------------LSLL-----------------
AqueK281_Aque   ------------------------------------------------------------
AqueK282_Aque   ------------------------------------------V-----------------
AqueK283_Aque   ------------------------------------------L-----------------
AqueK284_Aque   ------------------------------------------------------------
AqueK285_Aque   ------------------------------------------------------------
AqueK286_Aque   ---------------------------------------LSLA-----------------
AqueK287_Aque   ------------------------------------------------------------
AqueK288_Aque   ------------------------------------------------------------
AqueK289_Aque   ---------------------------------------Q--------------------
AqueK290_Aque   ------------------------------------------------------------
AqueK291_Aque   ------------------------------------------------------------
AqueK292_Aque   ------------------------------------------------------------
AqueK293_Aque   ------------------------------------------------------------
AqueK294_Aque   ------------------------------------------------------------
AqueK295_Aque   ------------------------------------------------------------
AqueK296_Aque   ------------------------------------------------------------
AqueK297_Aque   ---------------------------------------LSLA-----------------
AqueK298_Aque   ------------------------------------------------------------
AqueK299_Aque   ------------------------------------------------------------
AqueK300_Aque   ---------------------------------------V--------------------
AqueK301_Aque   ------------------------------------------------------------
AqueK302_Aque   ------------------------------------------------------------
AqueK303_Aque   ------------------------------------------------------------
AqueK304_Aque   ----------------------------------------V-------------------
AqueK305_Aque   ---------------------------------------LSLA-----------------
AqueK306_Aque   ------------------------------------------------------------
AqueK307_Aque   ----------------------------------------AF------------------
AqueK308_Aque   ------------------------------------------------------------
AqueK309_Aque   ------------------------------------------------------------
AqueK310_Aque   -----------------------------------------MSR----------------
AqueK311_Aque   -----------------------------------------P------------------
AqueK312_Aque   ----------------------------------------S-------------------
AqueK313_Aque   -----------------------------------------T------------------
AqueK314_Aque   ------------------------------------------------------------
AqueK315_Aque   -------------------------------------------Y----------------
AqueK316_Aque   ------------------------------------------------------------
AqueK317_Aque   -------------------------------------------G----------------
AqueK318_Aque   -------------------------------------------G----------------
AqueK319_Aque   ----------------------------------------SKRV----------------
AqueK320_Aque   ------------------------------------------------------------
AqueK321_Aque   -----------------------------------------F-S----------------
AqueK322_Aque   -------------------------------------------Q----------------
AqueK323_Aque   ---------------------------------------LSLA-----------------
AqueK324_Aque   ----------------------------------------ATNS----------------
AqueK325_Aque   -----------------------------------------S-A----------------
AqueK326_Aque   -------------------------------------------S----------------
AqueK327_Aque   ------------------------------------------------------------
AqueK328_Aque   ------------------------------------------------------------
AqueK329_Aque   -----------------------------------------SPSPSQNSTEDYPSSSYRL
AqueK330_Aque   ---------------------------------------L--------------------


Eph_Dmel        -------ILLI-IISI-H---FK--L---------------AHAD------------QVV
EphB6_Mmus      -------SLWL-LVLG-S-------S---------------VLAL------------EEV
EphB4_Mmus      --------LLC---WA------S--L---------------ATAL------------EET
EphB3_Mmus      -------PLLLP-LLL-P----A--G---------------CWAL------------EET
EphB2_Mmus      --------LGAALLLL------P--L---------------LAAV------------EET
EphB1_Mmus      --------LLL-FLLA------S--A---------------VAAM------------EET
EphA8_Mmus      -------ALWVVTAA--AAATCV--S---------------AGRG------------EVN
EphA7_Mmus      -------YIWLLGF-A-HT--GE--A---------------QAAK------------EVL
EPHA6_Mmus      -------FFLPLLT-A-WTGDCS------------------HVSN------------QVV
EphA5_Mmus      -------CLLLCAALR----TLL--A---------------SPSN------------EVN
EphA4_Mmus      -------FLFGICD-A-VTG-SR--V---------------YPAN------------EVT
EphA3_Mmus      -------VLLGCCVLS-CSGELS--P---------------QPSN------------EVN
EphA2_Mmus      -------LLWGCA-LA-A----A--A---------------AQGK------------EVV
EphA10_Mmus     -------PLCLALLLG-P---GR--P---------------GTAE------------EVI
EphA1_Mmus      -------LLLLL--CA-PL--PP--G---------------ARAE------------EVT
EphB6_Hsap      -------SLWV-LLLV-S-------S---------------VLAL------------EEV
EphB4_Hsap      --------LLC---WA------S--L---------------AAAL------------EET
EphB3_Hsap      -------LLLLPLLLL-P----A--G---------------CRAL------------EET
EphB2_Hsap      --------LGAALLLL------P--L---------------LAAV------------EET
EphB1_Hsap      --------LLL-LLLA------S--A---------------VAAM------------EET
EphA8_Hsap      -------ALWVVTAAA-AAATCV--S---------------AARG------------EVN
EphA7_Hsap      -------YIWLLRF-A-HT--GE--A---------------QAAK------------EVL
EphA6_Hsap      -------FFLPLLT-A-WPGDCS--H---------------VSNN------------QVV
EphA5_Hsap      -------CLLLCAALR----TLL--A---------------SPSN------------EVN
EphA4_Hsap      -------CLFGICD-A-VTG-SR--V---------------YPAN------------EVT
EphA3_Hsap      -------LLLSCSVLD-SFGELI--P---------------QPSN------------EVN
EphA2_Hsap      -------LLWGCA-LA-A---AA--A---------------AQGK------------EVV
EphA10_Hsap     -------QLCLALLLG-P---WR--P---------------GTAE------------EVI
EphA1_Hsap      -------VLL-L--CA-PL--PP--G---------------ARAK------------EVT
vab-1_Cele      -------FILVLQCLI-TIV-T---------------------SH------------QEV
Eph_Spur        -------IIFI-VLCA------W--T---------------SYAK------------EVK
AqueK267_Aque   -------LWYE--NT---------------------------------------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   -------Q-I----TS-C-------V---------------GSSV------------T-A
AqueK270_Aque   -------SLLLL-LLN-GTVQS----ND---CST-------EGFM------------ELS
AqueK271_Aque   -------TPL----SS-P---T---I---------------SSPY------------S-S
AqueK272_Aque   -------SSSLL-LLN-VA--G----DS---PCS-------EGFM------------DYS
AqueK273_Aque   ------------------------------------------------------------
AqueK274_Aque   ------------------------------------------------------------
AqueK275_Aque   ------------------------------------------------------------
AqueK276_Aque   -------VLMIL-LLN-EAATG---GGG---VCT-------EGFM------------DLS
AqueK277_Aque   ------------------------------------------------------------
AqueK278_Aque   -----------LNY-C-SD------------ECT-------ERFM------------ELS
AqueK279_Aque   -------SLLLL-LLN-GTVQS----ND---CST-------EGFM------------ELG
AqueK280_Aque   -------SLLLL-LLN-STVQS----ND---CST-------EGFM------------ELS
AqueK281_Aque   ------------------------------------------------------------
AqueK282_Aque   -------LL-VCFMSN-GILL-EV-NGE---SCT-------EGFM------------DYS
AqueK283_Aque   -------HY-KKYSSA-SDVW-SY-GAV---MYE-------IWSLGHKPFENSTNQECIR
AqueK284_Aque   ------------------------------------------------------------
AqueK285_Aque   ------------------------------------------------------------
AqueK286_Aque   -------VLILLLLLV-TSNEGAT-GGG---VCT-------EGFM------------DLS
AqueK287_Aque   ----------IPS----CNITYC--N---------------VPMS------------PA-
AqueK288_Aque   ----------VVSTTNSKSI----------------------------------------
AqueK289_Aque   ------------------------------------------------------------
AqueK290_Aque   ------------------------------------------------------------
AqueK291_Aque   ------------------------------------------------------------
AqueK292_Aque   ----------FVTLLP-DTLQAC--K---------------VGDV------------YQ-
AqueK293_Aque   -----------ISA-T--------------------------------------------
AqueK294_Aque   ------------------------------------------------------------
AqueK295_Aque   ---------LE------AN-------GE---SCT-------EGFI------------DYS
AqueK296_Aque   ---------VL------TI-----------------------------------------
AqueK297_Aque   -------VLILLL-LV-ASNEGAT-GGG---VCT-------EGFM------------DLS
AqueK298_Aque   ------------------------------------------------------------
AqueK299_Aque   ------------------------------------------------------------
AqueK300_Aque   ------------------------------------------------------------
AqueK301_Aque   ------------------------------------------------------------
AqueK302_Aque   ------------------------------------------------------------
AqueK303_Aque   --------LFLL-LLV-ASNEGAT-GGG---VFT-------EGFM------------DLS
AqueK304_Aque   ------------------------------------------------------------
AqueK305_Aque   -------VLILL-LLV-ASNEGAT-GGG---VCT-------EGFM------------DLS
AqueK306_Aque   ------------------------------------------------------------
AqueK307_Aque   ------------------------------------------------------------
AqueK308_Aque   ------------------------------------------------------------
AqueK309_Aque   ------------------------------------------------------------
AqueK310_Aque   -------FLLLSFLLS-TVAAQSIAPDDADPTCSDIPIRNVTFPN------------EKI
AqueK311_Aque   -------QQLQ--LP---------------------------------------------
AqueK312_Aque   -------IIAVICA----------------------------------------------
AqueK313_Aque   -------YFFK--VT---------------------------------------------
AqueK314_Aque   ------------------------------------------------------------
AqueK315_Aque   -------TPV----A---------------------------------------------
AqueK316_Aque   ------------------------------------------------------------
AqueK317_Aque   ---------A----EE-K---G---K---------------GRRL------------EAV
AqueK318_Aque   --------------QP-G-------------------------YD------------P-N
AqueK319_Aque   -------KMMLLTF----------------------------------------------
AqueK320_Aque   ------------------------------------------------------------
AqueK321_Aque   --------LFFLL-GN-DP---F--G---------------AVAI------------DC-
AqueK322_Aque   -------N-I----RT-N---A---V---------------GNYL------------T-S
AqueK323_Aque   -------VLILL-LLV-ANNEGAT-GGG---VCT-------EGFM------------DLS
AqueK324_Aque   ------------------------------------------------------------
AqueK325_Aque   --------M---------------------------------------------------
AqueK326_Aque   -------T-------------V---V---------------GGPL------------E-T
AqueK327_Aque   ------------------------------------------------------------
AqueK328_Aque   ------------------------------------------------------------
AqueK329_Aque   NPIPAIVALLVCLVLI-IVAF-VVL---------------------------------FI
AqueK330_Aque   ------------------------------------------------------------


Eph_Dmel        ----------LLDTT---------------------------------------------
EphB6_Mmus      ----------LLDTT---------------------------------------------
EphB4_Mmus      ----------LLNTK---------------------------------------------
EphB3_Mmus      ----------LMDTK---------------------------------------------
EphB2_Mmus      ----------LMDST---------------------------------------------
EphB1_Mmus      ----------LMDTR---------------------------------------------
EphA8_Mmus      ----------LLDTS---------------------------------------------
EphA7_Mmus      ----------LLDSK---------------------------------------------
EPHA6_Mmus      ----------LLDTT---------------------------------------------
EphA5_Mmus      ----------LLDSR---------------------------------------------
EphA4_Mmus      ----------LLDSR---------------------------------------------
EphA3_Mmus      ----------LLDSK---------------------------------------------
EphA2_Mmus      ----------LLDFA---------------------------------------------
EphA10_Mmus     ----------LLDSK---------------------------------------------
EphA1_Mmus      ----------LMDTS---------------------------------------------
EphB6_Hsap      ----------LLDTT---------------------------------------------
EphB4_Hsap      ----------LLNTK---------------------------------------------
EphB3_Hsap      ----------LMDTK---------------------------------------------
EphB2_Hsap      ----------LMDST---------------------------------------------
EphB1_Hsap      ----------LMDTR---------------------------------------------
EphA8_Hsap      ----------LLDTS---------------------------------------------
EphA7_Hsap      ----------LLDSK---------------------------------------------
EphA6_Hsap      ----------LLDTT---------------------------------------------
EphA5_Hsap      ----------LLDSR---------------------------------------------
EphA4_Hsap      ----------LLDSR---------------------------------------------
EphA3_Hsap      ----------LLDSK---------------------------------------------
EphA2_Hsap      ----------LLDFA---------------------------------------------
EphA10_Hsap     ----------LLDSK---------------------------------------------
EphA1_Hsap      ----------LMDTS---------------------------------------------
vab-1_Cele      ----------LFDLS---------------------------------------------
Eph_Spur        ----------LYDSN---------------------------------------------
AqueK267_Aque   ------------------------------------------------------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   ----------LAESQ---------------------------------------------
AqueK270_Aque   ----------LLEAK---------------------------------------------
AqueK271_Aque   SRVYSTTSTPFLSSP---------------------------------------------
AqueK272_Aque   ----------LLESK---------------------------------------------
AqueK273_Aque   ------------------------------------------------------------
AqueK274_Aque   ------------------------------------------------------------
AqueK275_Aque   ------------------------------------------------------------
AqueK276_Aque   ----------LLVAK---------------------------------------------
AqueK277_Aque   ------------------------------------------------------------
AqueK278_Aque   ----------LLNYT---------------------------------------------
AqueK279_Aque   ----------LLVAK---------------------------------------------
AqueK280_Aque   ----------LLVAK---------------------------------------------
AqueK281_Aque   ----------LLEAK---------------------------------------------
AqueK282_Aque   ----------LLQGK---------------------------------------------
AqueK283_Aque   ----------LVDSGYRLPPPPGCPKPMYKLMMQCCGYRIGVYQPPDDRSVVRFHYMNIS
AqueK284_Aque   ------------------------------------------------------------
AqueK285_Aque   ------------------------------------------------------------
AqueK286_Aque   ----------LLVAK---------------------------------------------
AqueK287_Aque   ----------N-------------------------------------------------
AqueK288_Aque   -----------IS-----------------------------------------------
AqueK289_Aque   -------------G----------------------------------------------
AqueK290_Aque   -----------LEAK---------------------------------------------
AqueK291_Aque   ------------------------------------------------------------
AqueK292_Aque   ----------SVD-----------------------------------------------
AqueK293_Aque   ------------------------------------------------------------
AqueK294_Aque   ------------------------------------------------------------
AqueK295_Aque   ----------LLEDK---------------------------------------------
AqueK296_Aque   ------------------------------------------------------------
AqueK297_Aque   ----------LLVAK---------------------------------------------
AqueK298_Aque   ------------------------------------------------------------
AqueK299_Aque   ------------------------------------------------------------
AqueK300_Aque   -------------AK---------------------------------------------
AqueK301_Aque   ------------------------------------------------------------
AqueK302_Aque   ------------------------------------------------------------
AqueK303_Aque   ----------LLVAK---------------------------------------------
AqueK304_Aque   ------------------------------------------------------------
AqueK305_Aque   ----------LLVAK---------------------------------------------
AqueK306_Aque   ------------T-----------------------------------------------
AqueK307_Aque   ------------------------------------------------------------
AqueK308_Aque   ------------------------------------------------------------
AqueK309_Aque   ------------VAK---------------------------------------------
AqueK310_Aque   ----------LLDSQ---------------------------------------------
AqueK311_Aque   ------------------------------------------------------------
AqueK312_Aque   ------------------------------------------------------------
AqueK313_Aque   ------------------------------------------------------------
AqueK314_Aque   ------------------------------------------------------------
AqueK315_Aque   ------------------------------------------------------------
AqueK316_Aque   ------------------------------------------------------------
AqueK317_Aque   I---------INDEE---------------------------------------------
AqueK318_Aque   ----------LVEVK---------------------------------------------
AqueK319_Aque   ------------------------------------------------------------
AqueK320_Aque   ------------------------------------------------------------
AqueK321_Aque   -------------SR---------------------------------------------
AqueK322_Aque   ------------------------------------------------------------
AqueK323_Aque   ----------LLVAK---------------------------------------------
AqueK324_Aque   ------------------------------------------------------------
AqueK325_Aque   ------------------------------------------------------------
AqueK326_Aque   ------------------------------------------------------------
AqueK327_Aque   ------------------------------------------------------------
AqueK328_Aque   ------------------------------------------------------------
AqueK329_Aque   ----------LLKKK---------------------------------------------
AqueK330_Aque   ------------------------------------------------------------


Eph_Dmel        --------------R----E----------------------------------------
EphB6_Mmus      --------------GE---T----------------------------------------
EphB4_Mmus      --------------LE---T----------------------------------------
EphB3_Mmus      --------------WV---T----------------------------------------
EphB2_Mmus      --------------TA---T----------------------------------------
EphB1_Mmus      --------------TA---T----------------------------------------
EphA8_Mmus      --------------TI---H----------------------------------------
EphA7_Mmus      --------------AQ---Q----------------------------------------
EPHA6_Mmus      --------------TV---M----------------------------------------
EphA5_Mmus      --------------TV---M----------------------------------------
EphA4_Mmus      --------------SV---Q----------------------------------------
EphA3_Mmus      --------------TI---Q----------------------------------------
EphA2_Mmus      --------------AM---K----------------------------------------
EphA10_Mmus     --------------AS---Q----------------------------------------
EphA1_Mmus      --------------TA---Q----------------------------------------
EphB6_Hsap      --------------GE---T----------------------------------------
EphB4_Hsap      --------------LE---T----------------------------------------
EphB3_Hsap      --------------WV---T----------------------------------------
EphB2_Hsap      --------------TA---T----------------------------------------
EphB1_Hsap      --------------TA---T----------------------------------------
EphA8_Hsap      --------------TI---H----------------------------------------
EphA7_Hsap      --------------AQ---Q----------------------------------------
EphA6_Hsap      --------------TV---L----------------------------------------
EphA5_Hsap      --------------TV---M----------------------------------------
EphA4_Hsap      --------------SV---Q----------------------------------------
EphA3_Hsap      --------------TI---Q----------------------------------------
EphA2_Hsap      --------------AA---G----------------------------------------
EphA10_Hsap     --------------AS---Q----------------------------------------
EphA1_Hsap      --------------KA---Q----------------------------------------
vab-1_Cele      --------------KV---G----------------------------------------
Eph_Spur        --------------A----F----------------------------------------
AqueK267_Aque   ------------------------------------------------------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   --------------P-T-------------------------------------------
AqueK270_Aque   --------------TG---STN---------------------NNG-PT--TAG------
AqueK271_Aque   --------------T-I-------------------------------------------
AqueK272_Aque   --------------AG---DTGI---------------------SH-SI--PNN------
AqueK273_Aque   ------------------------------------------------------------
AqueK274_Aque   ------------------------------------------------------------
AqueK275_Aque   ------------------------------------------------------------
AqueK276_Aque   --------------SV---PAT-----------------------P-ST--VNP------
AqueK277_Aque   ------------------------------------------------------------
AqueK278_Aque   --------------AE---RIG----------------------ID-PT--ETY------
AqueK279_Aque   --------------TG---STN---------------------NNG-QT--TAG------
AqueK280_Aque   --------------TG---STN---------------------NNG-PT--TAG------
AqueK281_Aque   --------------TG---STN---------------------NNG-PA--TAG------
AqueK282_Aque   --------------AT---TPMGNL-----------------RNNRL-S--NYK------
AqueK283_Aque   TNIDGIGKIQPLKIND---TNIRISASRDVDYESWTILIHPIVQDTD-CYSQLMAPDNIT
AqueK284_Aque   ------------------------------------------------------------
AqueK285_Aque   ------------------------------------------------------------
AqueK286_Aque   --------------AA---PAT----------------------P--ST--VNP------
AqueK287_Aque   ------------------------------------------------------------
AqueK288_Aque   ------------------------------------------------------------
AqueK289_Aque   ------------------------------------------------------------
AqueK290_Aque   --------------TG---STNNNG----------------------QT--TTG------
AqueK291_Aque   ------------------------------------------------------------
AqueK292_Aque   ------------------------------------------------------------
AqueK293_Aque   ------------------------------------------------------------
AqueK294_Aque   ------------------------------------------------------------
AqueK295_Aque   --------------AK---TPTGNL-----------------RNNRLSN--YKN------
AqueK296_Aque   ------------------------------------------------------------
AqueK297_Aque   --------------AA---TPV----------------------GS-LA--DNT------
AqueK298_Aque   ------------------------------------------------------------
AqueK299_Aque   ------------------------------------------------------------
AqueK300_Aque   --------------AA---TPVGSL-----------------AD--------NT------
AqueK301_Aque   ------------------------------------------------------------
AqueK302_Aque   ------------------------------------------------------------
AqueK303_Aque   --------------AA---TPVGSL-----------------AD--------NT------
AqueK304_Aque   ------------------------------------------------------------
AqueK305_Aque   --------------AA---TPVGSL-----------------AD--------NT------
AqueK306_Aque   ------------------------------------------------------------
AqueK307_Aque   ------------------------------------------------------------
AqueK308_Aque   ------------------------------------------------------------
AqueK309_Aque   --------------TI---DTRMRS-----------------GNNG-KT--IAG------
AqueK310_Aque   --------------NY---RSVFLV-----------------------------------
AqueK311_Aque   ------------------------------------------------------------
AqueK312_Aque   ---------------V---S----------------------------------------
AqueK313_Aque   ------------------------------------------------------------
AqueK314_Aque   ------------------------------------------------------------
AqueK315_Aque   ------------------------------------------------------------
AqueK316_Aque   ------------------------------------------------------------
AqueK317_Aque   --------------HET-------------------------------------------
AqueK318_Aque   --------------S-KFEY----------------------------------------
AqueK319_Aque   --------------TV---L----------------------------------------
AqueK320_Aque   ------------------------------------------------------------
AqueK321_Aque   --------------SL---P----------------------------------------
AqueK322_Aque   ----------------T-------------------------------------------
AqueK323_Aque   --------------AA---TPVGSL-----------------AD--------NT------
AqueK324_Aque   ------------------------------------------------------------
AqueK325_Aque   ------------------------------------------------------------
AqueK326_Aque   ----------------A-------------------------------------------
AqueK327_Aque   --------------EC---T----------------------------------------
AqueK328_Aque   --------------EC---T----------------------------------------
AqueK329_Aque   --------------RE---RV---------------------------------------
AqueK330_Aque   ------------------------------------------------------------


Eph_Dmel        ----------------------------ATL--------EWT-----RYPYGPQ------
EphB6_Mmus      ----------------------------SEI--------GWL-----TYPP---------
EphB4_Mmus      ----------------------------ADL--------KWV-----TYPQAE-------
EphB3_Mmus      ----------------------------SEL--------AWT-----SHPE---------
EphB2_Mmus      ----------------------------AEL--------GWM-----VHPP---------
EphB1_Mmus      ----------------------------AEL--------GWT-----ANPA---------
EphA8_Mmus      ----------------------------GDW--------GWL-----TYPA---------
EphA7_Mmus      ----------------------------TEL--------EWI-----SSPP---------
EPHA6_Mmus      ----------------------------GEL--------GWK-----TYPL---------
EphA5_Mmus      ----------------------------GDL--------GWI-----AFPK---------
EphA4_Mmus      ----------------------------GEL--------GWI-----ASPLE--------
EphA3_Mmus      ----------------------------GEL--------GWI-----SYPS---------
EphA2_Mmus      ----------------------------GEL--------GWL-----THPYG--------
EphA10_Mmus     ----------------------------AEL--------GWT-----ALPS---------
EphA1_Mmus      ----------------------------GEL--------GWL-----LDPPE--------
EphB6_Hsap      ----------------------------SEI--------GWL-----TYPP---------
EphB4_Hsap      ----------------------------ADL--------KWV-----TFPQVD-------
EphB3_Hsap      ----------------------------SEL--------AWT-----SHPE---------
EphB2_Hsap      ----------------------------AEL--------GWM-----VHPP---------
EphB1_Hsap      ----------------------------AEL--------GWT-----ANPA---------
EphA8_Hsap      ----------------------------GDW--------GWL-----TYPA---------
EphA7_Hsap      ----------------------------TEL--------EWI-----SSPP---------
EphA6_Hsap      ----------------------------GEL--------GWK-----TYPL---------
EphA5_Hsap      ----------------------------GDL--------GWI-----AFPK---------
EphA4_Hsap      ----------------------------GEL--------GWI-----ASPLE--------
EphA3_Hsap      ----------------------------GEL--------GWI-----SYPS---------
EphA2_Hsap      ----------------------------GEL--------GWL-----THPYG--------
EphA10_Hsap     ----------------------------AEL--------GWT-----ALPS---------
EphA1_Hsap      ----------------------------GEL--------GWL-----LDPPK--------
vab-1_Cele      ----------------------------SDL--------KWD-----QVSLRHDR-----
Eph_Spur        ----------------------------SGL--------YWT-----VYPPQDP------
AqueK267_Aque   ------------------------------------------------------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   ---------------------------------------RWI-----FG-----------
AqueK270_Aque   -----------------------LAES-VET--------RWI-----ITD----------
AqueK271_Aque   ------------------------------------------------------------
AqueK272_Aque   -----------------------IARV-DPS--------KWI-----IQDSS--------
AqueK273_Aque   ------------------------------------------------------------
AqueK274_Aque   ------------------------------------------------------------
AqueK275_Aque   ------------------------------------------------------------
AqueK276_Aque   -----------------------FSDS-NAR--------RWV-----IGGG---------
AqueK277_Aque   ------------------------------------------------------------
AqueK278_Aque   -----------------------MHAS-NNT--------LRV-----LQE----------
AqueK279_Aque   -----------------------LAES-EKT--------RWI-----ITERD--------
AqueK280_Aque   -----------------------LAES-VET--------RWI-----ITEED--------
AqueK281_Aque   -----------------------LAES-VET--------RWI-----MTEGD--------
AqueK282_Aque   -----------------------NPSG-VAT--------RWI-----IIKDN--------
AqueK283_Aque   LSSSITDVLFISDVIAVFPDIRLTCHG-IIT--------NWI-----IVANS--------
AqueK284_Aque   ------------------------------------------------------------
AqueK285_Aque   ------------------------------------------------------------
AqueK286_Aque   -----------------------FANSNFAR--------RWV-----IAGG---------
AqueK287_Aque   ------------------------------G--------NVSYTSLSVNSS---------
AqueK288_Aque   -----------------------S------------------------------------
AqueK289_Aque   --------------------------------------------------G---------
AqueK290_Aque   -----------------------LAES-VET--------RWI-----ITDQQ--------
AqueK291_Aque   ------------------------------------------------------------
AqueK292_Aque   -----------------------YVSN-IGG--------RWY-----LNVA---------
AqueK293_Aque   ------------------------------------------------------------
AqueK294_Aque   ----------------------------------------W-------------------
AqueK295_Aque   -----------------------PMEN-VAT--------RWI-----IIEDN--------
AqueK296_Aque   ------------------------------------------------------------
AqueK297_Aque   -----------------------LAEG-NEG--------RWI-----IRH----------
AqueK298_Aque   ------------------------------------------------------------
AqueK299_Aque   ------------------------------------------------------------
AqueK300_Aque   -----------------------LAEG-NEG--------RWI-----INGN---------
AqueK301_Aque   ------------------------------------------------------------
AqueK302_Aque   ------------------------------------------------------------
AqueK303_Aque   -----------------------LAEG-NEG--------RWI-----IDSG---------
AqueK304_Aque   ------------------------------------------------------------
AqueK305_Aque   -----------------------LAES-NER--------RWI-----IRQN---------
AqueK306_Aque   --------------------------------------------------SG--------
AqueK307_Aque   ------------------------------------------------------------
AqueK308_Aque   ------------------------------------------------------------
AqueK309_Aque   -----------------------LAES-VKT--------RWI-----ITEGD--------
AqueK310_Aque   -----------------------GAEG-ENR--------TWL-----TIDYDGGGVGRTG
AqueK311_Aque   ------------------------------------------------------------
AqueK312_Aque   ----------------------------SAY-----------------------------
AqueK313_Aque   ------------------------------------------------------------
AqueK314_Aque   ------------------------------------------------------------
AqueK315_Aque   ------------------------------------------------------------
AqueK316_Aque   ------------------------------------------------------------
AqueK317_Aque   ---------------------------------------SDL-----LT-----------
AqueK318_Aque   ----------------------------EYRRFSIDRTQLTQ-----Y------------
AqueK319_Aque   ----------------------------ALI-----------------------------
AqueK320_Aque   ------------------------------------------------------------
AqueK321_Aque   ------------------------------------------------SPTN--------
AqueK322_Aque   ---------------------------------------LRV-----L------------
AqueK323_Aque   -----------------------LAEG-NEG--------RWI-----IAGG---------
AqueK324_Aque   ------------------------------------------------------------
AqueK325_Aque   ------------------------------------------------SP----------
AqueK326_Aque   ---------------------------------------F--------------------
AqueK327_Aque   ----------------------------GHI-----------------------------
AqueK328_Aque   ----------------------------GHI-----------------------------
AqueK329_Aque   ------------------------------------------------------------
AqueK330_Aque   ------------------------------------------------------------


Eph_Dmel        --A--QTPGWVEE-----------------------------------S-----------
EphB6_Mmus      -------GGWDEV-----------------------------------S-----------
EphB4_Mmus      -------GQWEEL-----------------------------------S-----------
EphB3_Mmus      -------SGWEEV-----------------------------------S-----------
EphB2_Mmus      -------SGWEEV-----------------------------------S-----------
EphB1_Mmus      -------SGWEEV-----------------------------------S-----------
EphA8_Mmus      -------HGWDSI-----------------------------------N-----------
EphA7_Mmus      -------SGWEEI-----------------------------------S-----------
EPHA6_Mmus      -------NGWDAI-----------------------------------T-----------
EphA5_Mmus      -------NGWEEI-----------------------------------G-----------
EphA4_Mmus      -------GGWEEV-----------------------------------S-----------
EphA3_Mmus      -------HGWEEI-----------------------------------S-----------
EphA2_Mmus      -------KGWDLM-----------------------------------Q-----------
EphA10_Mmus     -------TGWEEI-----------------------------------S-----------
EphA1_Mmus      -------TGWSEV-----------------------------------Q-----------
EphB6_Hsap      -------GGWDEV-----------------------------------S-----------
EphB4_Hsap      -------GQWEEL-----------------------------------S-----------
EphB3_Hsap      -------SGWEEV-----------------------------------S-----------
EphB2_Hsap      -------SGWEEV-----------------------------------S-----------
EphB1_Hsap      -------SGWEEV-----------------------------------S-----------
EphA8_Hsap      -------HGWDSI-----------------------------------N-----------
EphA7_Hsap      -------NGWEEI-----------------------------------S-----------
EphA6_Hsap      -------NGWDAI-----------------------------------T-----------
EphA5_Hsap      -------NGWEEI-----------------------------------G-----------
EphA4_Hsap      -------GGWEEV-----------------------------------S-----------
EphA3_Hsap      -------HGWEEI-----------------------------------S-----------
EphA2_Hsap      -------KGWDLM-----------------------------------Q-----------
EphA10_Hsap     -------NGWEEI-----------------------------------S-----------
EphA1_Hsap      -------DGWSEQ-----------------------------------Q-----------
vab-1_Cele      DDVWM-EETWRNP-----------------------------------A-----------
Eph_Spur        --DSQTYVGWTES-----------------------------------G-----------
AqueK267_Aque   ------------------------------------------------------------
AqueK268_Aque   ------------------------------------------------------------
AqueK269_Aque   ----------RHF---------------------------------RPK-----------
AqueK270_Aque   ------------R---------------------------------MFSE----------
AqueK271_Aque   ------------F---------------------------------SPISTGVIGGSIVA
AqueK272_Aque   ------------N---------------------------------KF------------
AqueK273_Aque   ------------------------------------------------------------
AqueK274_Aque   ------------------------------------------------------------
AqueK275_Aque   ------------------------------------------------------------
AqueK276_Aque   ------------N---------------------------------SF------------
AqueK277_Aque   ------------------------------------------------------------
AqueK278_Aque   ------------Y---------------------------------QF------------
AqueK279_Aque   ------------K---------------------------------QFSE----------
AqueK280_Aque   ------------K---------------------------------EFSK----------
AqueK281_Aque   ------------K---------------------------------KFSK----------
AqueK282_Aque   ------------I---------------------------------KFT-----------
AqueK283_Aque   ------------LVTATVKIRHANNLTTTALSVNISNAIPISSLLYNFTMSDEITVQPGD
AqueK284_Aque   ---------------