Protein (view, download) , Domain (view, download)
29569_Tthe_PI4K  MATGGIE-PAC-SK----------------------------------------------
13773_Tthe_PI4K  MLEHLLE-SALIKLYQGNFTDSKQIVQAISDILLDETLDDSQISLCNSKIFNSDLNLFTY
20618_Tthe_PI4K  MSHIMQE-I-S-KLFEQFKKAKNQES---ERL-------------------AADLQQ-LY
20619_Tthe_PI4K  MQEEKLL-K-K-NT----------------------------------------------
n8_Tthe_PI4K     MQQGSQN-LQS-RDISQ------------D------------------------------
n29_Tthe_PI4K    MRLNLNRNIYQ-KLKE--------------------------------------------
n73_Tthe_PI4K    MSEENSI-IL--KTK---------------------------------------------
n131_Tthe_PI4K   MDRNSHS-R----NGK--------------------------------------------
n502_Tthe_PI4K   AYAFSLQSLQK----K--------------------------------------------
n508_Tthe_PI4K   MDAISIV-IK--------------------------------------------------
n545_Tthe_PI4K   HFL-NNR-I---------------------------------------------------
n679_Tthe_PI4K   MKKGPTE-YIQ-HTL----------L---DQL----------------------------
n737_Tthe_PI4K   MAEDTQK-----------------------------------------------------
n858_Tthe_PI4K   MAQFFNQ-KQK-ENEEE------------A------------------------------
GK310_Glam_PI3K  MQVSIIS-PKG-A-I---------------------------------------------
GK311_Glam_PI3K  MKGLNVE-INS-M-V---------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  LENNRTYKDNLQAQIRKGLFRTIAAYIKLRKLKVFEYIELICKNCMSLFKKEESN-QAKE
20618_Tthe_PI4K  LKNNQYY-----DEIYHGLIK--------------------------LINSNDI--NEKY
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ----------------------------------------------------------KY
n29_Tthe_PI4K    -----------------------------------------------------NSQKSDN
n73_Tthe_PI4K    -----------------------------------------------------KP-HGIL
n131_Tthe_PI4K   -----------------------------------------------------SPISSSN
n502_Tthe_PI4K   -----------------------------------------------------AV-RKKQ
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   -----------------------------------------------------NP-----
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ----------------------------------------------------------QY
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  --------KFL--MFDQFQML-------------------IYL--EATIFNDN--IG---
13773_Tthe_PI4K  TSLS-PIIKIIK-CIDNSELL-----EKII----DPKNTISA------LLN---------
20618_Tthe_PI4K  NSLI-GIEQISY-VVQEDQYL----N-------------LWSKFN--SLVFQLLE-----
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     AVTC-RIEKFII-CVDPDSRQ-------------------IYGLN--PQNNDLYIFL---
n29_Tthe_PI4K    -QIT-RQDEIKF-CQIIQGSLVGQQLL-SSNYDIMPFQLGLILWK--NLPNEFSSVL---
n73_Tthe_PI4K    ASVF-CCKCFKC-CQEIDQSL-----L-TS----NDRKKILN------------------
n131_Tthe_PI4K   -NLG-DQKELNQHDYI---------------FSLE------------RVQQQIPI-----
n502_Tthe_PI4K   -ILA-SIKRYII-IHHFIKKL-----I-LY-M-K--KKALESIVN--RRTNRVSPSKLTL
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   -----P-VKFKI-CC---------------------------------------------
n737_Tthe_PI4K   ---------LLI-CVDPKTKW-------------------FYTIN--TNTNELRIEE---
n858_Tthe_PI4K   -------EKWLI-CVDPKSKM-------------------FYTVN--SVTNELHIET---
GK310_Glam_PI3K  CTFCTRPDVAIV-ALEFESRC----RLGLE----DTPILLQYTSKSATFTNELSTLG---
GK311_Glam_PI3K  ----------------------------------TPSYAV--------------------


29569_Tthe_PI4K  E------------TTQNRINQKI-----VIGLSKDLLKSKEAKA---SQQNFEQANRLNS
13773_Tthe_PI4K  EIK----------------------------------------FCKPTQKVKGSIWNLIG
20618_Tthe_PI4K  -QTGD------------------------------------EKVIKKSAEVYGRLLRLGG
20619_Tthe_PI4K  -------------------------------------------------EVFGRLLRLGG
n8_Tthe_PI4K     DEKLKNQIDYDGDRVQAEEMQNVKF---LDSLREQFLEDNK-------------------
n29_Tthe_PI4K    DN---------------L--QNLIGQGALTKYLN--------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   -P---------------Q------------------------------------------
n502_Tthe_PI4K   S-------------------NDMVEKYMPIRIYK--------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   D-----------------AEQNVVM-----------------------------------
n858_Tthe_PI4K   D-----------------A--DDIM-----------------------------------
GK310_Glam_PI3K  EC---------------LANLNVVS---VDSLQFHVLPLDL-------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  IEQSNQKNR----VQAKQEGIQGSGFLQVQQSLSVNRPS---------------------
13773_Tthe_PI4K  IIFQFFTDQLEDDLK---AEIQTVCFKELQVQMASQKPEVSYVSGMFKSFRYS----LKE
20618_Tthe_PI4K  TRITNL----------------------LTDQIQKPIHW-------------IFKN-SGD
20619_Tthe_PI4K  QRVQNV----------------------LVGYISNIIES-------------LFLTSTKD
n8_Tthe_PI4K     --------------------------IELSQQVSKNLN----------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    -------KLI-----------------------------------------KN----TSD
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ----------------------------------------------------D----LSE
n679_Tthe_PI4K   ---------------------------------------------------------IND
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  --------------------------ASTPNH-----Y----------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  IHL------------------SNKELEDLYKMIKIGITEIKDVQILDDSKEIIDKVLGLI
20618_Tthe_PI4K  NKKFSGLLVLKELLEQASFVTF--------------------KQFISNTEDYRTNLWNLI
20619_Tthe_PI4K  NQKYASLLVLKELLEQSPFITF--------------------K-IIANTENFRSKIWSHI
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    PQL------------------Y------------------------D-AHGL-S------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   -----------DIL----------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   KHI------------------W--------------------------------------
n679_Tthe_PI4K   QKK-----VL---------------------------------RYFFNDEDGSSKLENLE
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ---------SSNNLMDQT-AQIHIQKQDSNSAKSSKSSISYNSETNYLKMNAQP---SN-
13773_Tthe_PI4K  SHNNRDVKENASDCLESLMALLAI-ELDSSYKNH---ELSFNY-----------------
20618_Tthe_PI4K  KHKTTLLREAALSFFDVLLKQISLKEQDIQDREY---NTFFTDICQSMNARQEEVVIGNI
20619_Tthe_PI4K  KSKNILVREAALSFFDQYMQHISLKEQEVQEKEY---SAYYTDIESYLKQKEEEMIIGNI
n8_Tthe_PI4K     ------------SIS--------------------------NHQTDVIKQNGQL---ST-
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ----QNIKKKNSQISDPIQILI-------GL-----------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   AMV---------------TAQLVVNEKKI-------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  -------IKER----V------------------------------------EQITEEPV
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  SALKILVTYPNSEQF---------------------------------------------
20619_Tthe_PI4K  AVLKIIFSYPSQEQF---------------------------------------------
n8_Tthe_PI4K     -----STIQQNGQQTNQEQALNPAVNAVDNAILGVSEIKKKYSIDDYRIKGKKAIE----
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   -----------------------------------------------RQKADEAIK----
n858_Tthe_PI4K   -----------------------------------------------KDAAKKAIN----
GK310_Glam_PI3K  ------------------------------------------------TSEPETVF----
GK311_Glam_PI3K  -------------------------------------------------KVAPTV-----


29569_Tthe_PI4K  DEHLDFKYQKLLDVIKGSGDKNNLGF----------------------------------
13773_Tthe_PI4K  ------IIQKMSFLINQE-----------RQQIYTASITVIIKSIGIFSKAIAKHLGQDQ
20618_Tthe_PI4K  ---NDQQFSQMCMYVLSK-----------KD-ENSNIQKTVIEALPALAKFKKQAFAEKF
20619_Tthe_PI4K  ---TDTQYSNMCKYVLSK-----------KEHTYQSIQKIVIDTLPILSKFKRQHFCENF
n8_Tthe_PI4K     NIEK---IIQINDG----------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------Y-----------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ---------------------------------QPAQQTLFID---------RMLFEQNI
n737_Tthe_PI4K   DLYK---IINLDDS----------------------------------------------
n858_Tthe_PI4K   DLRQ---IIDYDKS----------------------------------------------
GK310_Glam_PI3K  DLLESWQYHKLDTI-----------LLSFT------------------------------
GK311_Glam_PI3K  ----FLQHIVLDKS-----------LLAGH------------------------------


29569_Tthe_PI4K  --------LQQKIDY-LTMISNRLQISLFDLLNLLPS-----------------------
13773_Tthe_PI4K  LQLFFKQMINLSEVRL-----------------------------------LKHIEKDGV
20618_Tthe_PI4K  FIKTTEFLLQRINPPKAKSITHELIVSYYDTLNKISQ-----------------------
20619_Tthe_PI4K  LCETIDHIRNLIGSNKFKSPSQDLLISYYDTLDKICS-----------------------
n8_Tthe_PI4K     -------------------------------------------------NWLINH-----
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ---------------------------------------------------LSENDEDKN
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   -------------------------------------ERLKHPYKNLACELLLAQ-----
n508_Tthe_PI4K   -----------------------------------------DPENNNL------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   -------IFNY-------------------------------------------------
n737_Tthe_PI4K   -------------------------------------------------YWLFRS-----
n858_Tthe_PI4K   -------------------------------------------------SWLFES-----
GK310_Glam_PI3K  ----ILHYQSLVAEA-LVSKKNKLMITAHTQPDISPS------------HPFLTS-----
GK311_Glam_PI3K  ----MLHGF---------------------YPDLHIIFKLMTPPDTLLAPPMNSS-----


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  NSVVDFQPVEDETMKKGTSFKTILYRQKQVISFITSFANIISQLDKLYEDESQSLLRLCM
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    DQ----------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  --------------------------------------------------KYLAQLF---
13773_Tthe_PI4K  VGFKQFSSFYEKYKEPLNEGIVQLMREMKKHQSIYIIWLENLVQNGLVQS-------IKL
20618_Tthe_PI4K  --------------------------------------------------CIDSTIYAKL
20619_Tthe_PI4K  --------------------------------------------------SLDISIIKKI
n8_Tthe_PI4K     ------------------------------------------ERADQYRR-------RKL
n29_Tthe_PI4K    ------------------------------------------DF----------------
n73_Tthe_PI4K    -----------------------------------------------FMQ----------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------QFQKQIQQ-------EQM
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------EQAKELQR-------RKI
n858_Tthe_PI4K   ------------------------------------------EQAKRFQR-------RKI
GK310_Glam_PI3K  ------------------------------------------PLARDLATKVTSAILRAI
GK311_Glam_PI3K  ------------------------------------------IQSTIICK-------KTQ


29569_Tthe_PI4K  QDYKQQENVMVNIILASVSGLSQP--NKIFEDIKIDL-----------------------
13773_Tthe_PI4K  PD-------------NSFLSM---------------------------------------
20618_Tthe_PI4K  PENMKD---L---VF--------QSIQNITRQIR--------------------------
20619_Tthe_PI4K  PDDKKK---L---IF--------DEIKRVCKTIQ--------------------------
n8_Tthe_PI4K     PNY---------------------------LLQRTDQ-----------------------
n29_Tthe_PI4K    -----------------------------------------------DFESQSYPLLNV-
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ESQ---------------------------KFGKEMSLKTIQQNQHQQIDQERNDISTLQ
n508_Tthe_PI4K   ---------------------------------G--------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   --KYKD---L---SY--------NSIIAITLWCSQ-------------------------
n737_Tthe_PI4K   PSY---------------------------LLNKDCS-----------------------
n858_Tthe_PI4K   PSY---------------------------LLHKDSS-----------------------
GK310_Glam_PI3K  PTHNQNKS-VDLGIF--------Q--QEIADWIAMDL-----------------------
GK311_Glam_PI3K  LTY---------------------------VWNSQQL-----------------------


29569_Tthe_PI4K  -----------------GDKFDYENQYLKAHCQNYED--------CLNQDEQE-------
13773_Tthe_PI4K  --------------------------------QEYYE--------TLKSCSQFWKSLF--
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     -----------------NHPTYICQSPLSEV-----------------------------
n29_Tthe_PI4K    --------KL----KAIV------------------------------------------
n73_Tthe_PI4K    -------------------------------------------------------NLL--
n131_Tthe_PI4K   --------NF----PPKE------------------------------------------
n502_Tthe_PI4K   NKRTNNDVSILNENQQDQTNAFINQQNFENA-----------------------------
n508_Tthe_PI4K   ------------------RHSVFDI-----------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   -----------------KYPKYLCQSNLSLA-----------------------------
n858_Tthe_PI4K   -----------------EYPTYLCQSNLSLA-----------------------------
GK310_Glam_PI3K  -----------------RAQLSF--SVIEQHVLNASSCSSAHSLPP------RQERLLPG
GK311_Glam_PI3K  -----------------TFPISI--SNLPQA-----------------------------


29569_Tthe_PI4K  -QQSLEDDEELEELTP----------QIKTRIFFSRYIIPLVLHQLIDFKQDPSIQMSSI
13773_Tthe_PI4K  N-CQLWTDETLHHFS----------AQFFQY-----------------------------
20618_Tthe_PI4K  --------QDLQEKKP----------YISFRIQCLMSIIKNFQHKYQDLINDEDLLINNI
20619_Tthe_PI4K  --------KDLQDKKE----------YIPSRVTCLQNIVKVFSTRYSELI-DEENLIDDL
n8_Tthe_PI4K     ------F--------VK-------------------------------------------
n29_Tthe_PI4K    ----------------K-------------------------------------------
n73_Tthe_PI4K    R-CRTNQRDDVEYYI----------PQLCSF-----------------------------
n131_Tthe_PI4K   ----------------Q-------------------------------------------
n502_Tthe_PI4K   ------Y--------QD-------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   -------RDDLEFYL----------PQICNF-----------------------------
n679_Tthe_PI4K   --------KNKDEKKP----------LGCTTISLFDDQFRLRQGKYHLYIWPDTL-----
n737_Tthe_PI4K   ------F--------SK-------------------------------------------
n858_Tthe_PI4K   ------F--------AN-------------------------------------------
GK310_Glam_PI3K  KEGSLPD--------SQVSSLHKLGPC---------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  LGRLEDIYGMQQSQAQLGSAQNINTQDSGGSLSQNSNASQNLFIQ---------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  LF----------------------------------------------------------
20619_Tthe_PI4K  IF----------------------------------------------------------
n8_Tthe_PI4K     -----------------------------------EVTI----II---------------
n29_Tthe_PI4K    -----------------------------------NLEI----NILS-------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   -----------------------------------S------------------------
n502_Tthe_PI4K   -----------------------------------QNEI----NLFRNNSNNFENSGKYF
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   -----------------------------------VNSI----NL---------------
n858_Tthe_PI4K   -----------------------------------VNSI----KL---------------
GK310_Glam_PI3K  -----------------------GVKNNSGIDHTHMNPS----HN---------------
GK311_Glam_PI3K  -------------------------------AHFHISIY----VH---------------


29569_Tthe_PI4K  --------------KV-----------------------------------Y-I------
13773_Tthe_PI4K  ---------------------IIQLLENTDLSYKVVYTQQI-EEDEIKDKNQME------
20618_Tthe_PI4K  ---------------NGLYPQSIEFLKH---------IQKY-NR----------------
20619_Tthe_PI4K  ---------------NGLYPQTVEFLEN---------IQSY-KMDEIKENTS--------
n8_Tthe_PI4K     --------------KV-----------------------------------N-L------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------IA----------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   FLFLVNILSNNLKVQ-----------------FNQANVESFQDEDEIQCENQEDGGLSKD
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------FV----------------------------
n679_Tthe_PI4K   ------------------------------------------PD----------------
n737_Tthe_PI4K   --------------NV-----------------------------------N-L------
n858_Tthe_PI4K   --------------VV-----------------------------------L-L------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  --------------GV-----------------------------------L-L------


29569_Tthe_PI4K  --TNLREFYRSLKFFMEKIY--RKNNDKAQYVL--------------------------S
13773_Tthe_PI4K  --IEQ-----DKESKIQDIIREIQQVQYVANNEVDLQFFYRVTLLFDSVLPSIKPALFSN
20618_Tthe_PI4K  ----------------------KERTRTEVS----------------------------S
20619_Tthe_PI4K  ---------------VSEEN--RKKEKKEFS----------------------------T
n8_Tthe_PI4K     --INF-------------------K-----------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ----F-----QQEFKVQKMVNYIKQAGQINFYFAHLL-----------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   IECQQ-----NQENQVQQQQNP--------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ----F-----HEELKNDSLKEFLKKAGKIDFFFGHML-----------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   --DEY-------------------I-----------------------------------
n858_Tthe_PI4K   --GNY-------------------E-----------------------------------
GK310_Glam_PI3K  ------------TILIENLQ--RRIDESGAC----------------------------A
GK311_Glam_PI3K  --GST-------EF----PL--YNE-----H----------------------------F


29569_Tthe_PI4K  Y-----------------------------------------------------------
13773_Tthe_PI4K  YI-YQFYKSIILKLRKLPRSIVLLKLLRCLNEYIEKNNILKGLKKYI-------------
20618_Tthe_PI4K  SIQYRLLLCIITILSKH-KNL---------------------------------------
20619_Tthe_PI4K  FIQYRLLLYIITTLQKQ-RNV---------------------------------------
n8_Tthe_PI4K     -------------------SQ---------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------YFYI-----------------RSLSYIVNKNE--------KYQLLAIEKMQLEL
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------CFYL-----------------KSVAQTVNKNQ--------IQDIPQVWNVLNEF
n679_Tthe_PI4K   --------------TSY-TSI---------------------------------------
n737_Tthe_PI4K   -------------------NQ---------------------------------------
n858_Tthe_PI4K   -------------------DK---------------------------------------
GK310_Glam_PI3K  HLDWEVVTASLDGVENP-LGV---------------------------------------
GK311_Glam_PI3K  ALRCMMHTCLIKPIAYT-DDQ---------------------------------------


29569_Tthe_PI4K  -----------------------LQKICKNE---RDYELDQTLFSYEDLK----------
13773_Tthe_PI4K  -KKDITSQIKIFFSELYKNLGKYQ-DEL-LI---D-----------CLKTMLSIPFEVLL
20618_Tthe_PI4K  ---------------FP------Q---SLNPNND-KDKNFYQKLILNTDK----------
20619_Tthe_PI4K  ---------------TP------L---TLPPVND-SQKKFQLKLRQYEDR----------
n8_Tthe_PI4K     ---------------LY------D-KQM-LI---N-----------KEKT----------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    YD---------FFSEHY------S-NKY-LT---A-----------KEL-YKEINQKQ--
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   -------------------------------IQE-EQCSVCLIEFQESDQ----------
n508_Tthe_PI4K   --------------------------------------------KPNKQQ----------
n545_Tthe_PI4K   FS---------SFVEFY------S-SKQ-LM---S-----------AEM-VENLAMGK--
n679_Tthe_PI4K   ---------------TP------G---LVTDDN---------------------------
n737_Tthe_PI4K   ---------------LR------E------------------------------------
n858_Tthe_PI4K   ---------------LQ------DWKQE-PP---Q-----------NEKK----------
GK310_Glam_PI3K  ---------------SP------AS--PLVPLNPISYPHFTLVFSFPEDT----------
GK311_Glam_PI3K  ---------------IS------E---ELPP---IE-LSFELALPHSEDR----------


29569_Tthe_PI4K  -------------------------R--DRIV-L--------------------------
13773_Tthe_PI4K  IDNYSFFRKNLIVALKKGFELGVQNVSMGFAAIECLQKIIKRSKNRVVFKYLKLVIPYLS
20618_Tthe_PI4K  -------------------------TLSTDEKAIANAI----------------------
20619_Tthe_PI4K  -------------------------I--KGDKEISNAI----------------------
n8_Tthe_PI4K     -------------------------T----------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    --NHN-------------YQDQNGHYVAPNAEEQQIAD----------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   --KYAVP-----------YKLNKSNNGNSNEANMKIKQ----------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   -------------------------Q--EEK-----------------------------
GK310_Glam_PI3K  -------------------------T--DRRPAI--------------------------
GK311_Glam_PI3K  ------------------------------TRTI--------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  EYLSITKGELEEI----TSDMKYKVQSNNQQRDIFNLTVSELGQRKKDLIERVTNLLGDI
20618_Tthe_PI4K  ---QTLSTFGFSN----YENELANFVK---------------------------------
20619_Tthe_PI4K  ---QTLSTFKFKT----YEKELTNFLK---------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ---DVIQKYGTTEQDEIKQYPQFKLKSTNI------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ----IRITICDHI----FH-----------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ---EVISSYGTSY----YQRHKINILPEDI------------------------------
n679_Tthe_PI4K   -------------------IKQINFSH---------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  GGESHLIVLSEKGFQGNVERQLLSEFENLQISKKGVSLISWDYEAKVLFPLPLLAKKIDI
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ---ILKNY--KRKIILNE--------SN------LKNPRTFTNNQTQVCNPENI------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ---SLQNYINIQDFIQIK--------ER------VESSQEVEN-MDNGIPPENQK-----
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  NLTKLLPRMVELTLNPDDKIKVYACEAIHAITIYMIGTQASSIQGGQKKRGRDMENLIKS
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  KEEFSKIYSKLFPTIFSIGSNSSHPSCQLMNQLILQISRWFANSKQLESPEVAELLDNIM
20618_Tthe_PI4K  --------------------------------------------------------DNVL
20619_Tthe_PI4K  --------------------------------------------------------DNVL
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ---------Q---------DEM--------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------------------------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   --------LN-------KETEI--------------------------------------
n679_Tthe_PI4K   --------------------------------------------------------QKTE
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  NFISSKDNNNLRELA--ANCLGQFIKWTLKQN--TEQEIKVNHSNIKSALRRIISFSGQP
20618_Tthe_PI4K  DYLDNK-NKNIRKAAAKAGCLLYVK-KERGQS--I-------------------------
20619_Tthe_PI4K  DYLDNK-NKIIRKAAAKAGCLLCVK-KGKDNL--I-------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   -----------------SECLLQWL-KSQENCPNC-------------------------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   QAFTNV-NKFPQK-----------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  --------------------------------------------------------YRL-
13773_Tthe_PI4K  DLSKRFGALLALKEVVNNIKNESFLVDKFIMETIQTSMRIVQKTGVSNEVEDNFNILIKL
20618_Tthe_PI4K  ---------------SKNIMYE--ILEKFMSVAISDSEDEIRQTMLK-SLNENFDQYLN-
20619_Tthe_PI4K  ---------------SKSVMYK--ILEKFMSVAVSDAEDEIRQTMLK-SLNENFDQYLI-
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ---------------RKDLQRR--KLKYWYSIQVRKQ---LRIMMND-RSAYSINLFLG-
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  AMSGTKK----------------------------------------------LL---FN
13773_Tthe_PI4K  QTNIIQK----------------------------------------------NYKTLK-
20618_Tthe_PI4K  EPNYLKK----------------------------------------------LF---L-
20619_Tthe_PI4K  EPIYLKK----------------------------------------------LF---F-
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   QPKSKSTTFGEQVAESNQQQQFYRKTPMFPFNKVKQLKRFNSLQGEFYHNSQTQ------
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  YLQD------------KQILTKYAGNCIFDFKKKEIFLDYYKRFITPAEASLS------N
13773_Tthe_PI4K  AKNENRSGQFKLLDSLLDWLYSYGFF----------------------------------
20618_Tthe_PI4K  CVNDSNTQVQQLVLTILCRLSRYNPSDIIPFLKKTLF-EFL-------------------
20619_Tthe_PI4K  CVNDSNLEVQQLALTTLCRLSKYNPSDIVPFLKKTLY-EYI-------------------
n8_Tthe_PI4K     -----------------------------N-----------------------NQPLE--
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   ------------------------GNIL------------------------N------N
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   -----------------------------------------------------KKPAEVD
n858_Tthe_PI4K   --------------------------MIKD-----------------------DKPIK--
GK310_Glam_PI3K  ----------------------SRSWCISDEH--RASLDKTTAITVDAQQSLS------S
GK311_Glam_PI3K  ----------------------ANTVCYAPEGLFRKTSMGSITTTADAHLATAKSPAHVS


29569_Tthe_PI4K  G---MDDTVFR-------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ----DQYSVK--------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   GQKTETDNIQQTNQLGQNNSKSIQRPTQVEYQEVSFNGAIVRIPKPKIETNTQKVIEVEN
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   W---DCKSLT--------------------------------------------------
n858_Tthe_PI4K   ----YEKRIE--------------------------------------------------
GK310_Glam_PI3K  N---LENTIT--------------------------------------------------
GK311_Glam_PI3K  L---LEMNAL--------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   EEEEEKKEQLEEQNQDICIQQIQNEQIIEQNSKIKNDSLSIQQENKSDLNQNGSNKHIDL
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   KQNDNQNMFECISLNNSIQIEDCQQENSQCFRKRKHLRESWFKKSEQSKQILNIEEDNSS
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   MKTIEKDNFNQKIEEQQIAGDYKSIRKDSLNQENIKQNISDDESIINLNINQTNNQIKNH
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   IEIKTKQIDLQNQQQQKNVNLDLSETSKNKQNDINHSIKESNKSMNENNFGQKLKQSDDQ
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   FNCELIDLENRQESPCKIDSITQKLELNEDFDPSIFRLQTEDLTKSNQIKQVNKCKEKSH
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   TAIRNNKKIIQQDTTPSKRTKQTKQTKQLNLNSLSSKDTNPSPKLFITPQKNSFNNHQIQ
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ------------------------------------------------------------
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------------------------------------------------------------
n502_Tthe_PI4K   KYQPCSSPILLQNASSILNNKIKTQNETLVSQQEHKIFLKTVITKFNKFNSKLASIMNKR
n508_Tthe_PI4K   ------------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    ----------------------------------------------------------FL
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ----------------------------------------------------------LL
n502_Tthe_PI4K   PVKETVEQKRPTWFSKLPVNIEELQQTGALLGITTAPDDSFSQSPTKDRDSDHISTKELF
n508_Tthe_PI4K   -------------------------------------------------------TRRIL
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    NSFIMKLKTNE---KVNYNQFSTLWINQLILHDNKNKLIDLMDIKLLKDKLVEILNLIIE
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   QMFNAELFTTEYLIEYLYKKFETPGVHEYLVN----------------------------
n502_Tthe_PI4K   KLFNRKDFKIDQLLKHFYYQYTKIGIHDYLVN----------------------------
n508_Tthe_PI4K   QELNEPSIQIEKLLKYLYLFYEYIGVHDFIIN----------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ---------------------------------------ISAN-----------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ---------------------------------------IKAE-----------------
n29_Tthe_PI4K    ENQKLKNSMSKREQYMNLFKENLNELYLVIGLANKFSQFLSFSLSTPDNLVNIYEFCFQF
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   ------K-LYAVPHYE--------------------------------------------
n502_Tthe_PI4K   ------K-LYSYGEAD--------------------------------------------
n508_Tthe_PI4K   ------K-LYNYSEAE--------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ---------------------------------------IEAG-----------------
n858_Tthe_PI4K   ---------------------------------------IEAG-----------------
GK310_Glam_PI3K  ---------------------------------------ISPL-----------------
GK311_Glam_PI3K  ---------------------------------------LSSS-----------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ---------------------------------NSSYLVRKSSFELWQSILNREDSDISC
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ---------------------------LVTAFLYKL------------------------
n29_Tthe_PI4K    ITVCQKFQEIEKLPYAIIFYLKLVRQRRQKA-----------------------------
n73_Tthe_PI4K    ---------------------------------KGS--FNIEQNGFAS------------
n131_Tthe_PI4K   ------------MDFYISFIVYLVITR---------------------------------
n502_Tthe_PI4K   ------------LNFYMSELCYLYITR---------------------------------
n508_Tthe_PI4K   ------------LNFFMTQLCYLCIQR---------------------------------
n545_Tthe_PI4K   ---------------------------------NGNGMEHDLNNGFLS------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ---------------------------LVT------------------------------
n858_Tthe_PI4K   ---------------------------LVT------------------------------
GK310_Glam_PI3K  ---------------------------LT-------------------------------
GK311_Glam_PI3K  ---------------------------IT-------------------------------


29569_Tthe_PI4K  ---------LENYCRA-----------------------LQTSQHKICALRNAIALIRFL
13773_Tthe_PI4K  KKFLAKRKQGDNLFGDQIKQLKLAI--NSQSYFREINVLLSQLDVVTFIVKNNFFSVQEE
20618_Tthe_PI4K  --------------------SQLKIN--NLENEKQM---INLLSSLTCLIKNGPELVRPH
20619_Tthe_PI4K  --------------------SQLSYNKKRFENEKKI---INLLKGLVCLIKNDTEVVKPH
n8_Tthe_PI4K     --YFNKNKNR------ADEVL------------------KKTLREVYYKYKIKLQPQD--
n29_Tthe_PI4K    ----------------FDQVV------------------KEQSRKVFESTFKLFENHI--
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   -------------------------------------------PSVYLEQFLASLSQQ--
n502_Tthe_PI4K   -------------------------------------------DSEMLKKFLVDMSSR--
n508_Tthe_PI4K   -------------------------------------------GSQSLEKFLVDKCAT--
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ---------G------ADEVI------------------KNILRKIYKEYKIALKPKDQ-
n858_Tthe_PI4K   ---------G------ADEVI------------------KNILREIFKQAKVKLEPNNP-
GK310_Glam_PI3K  --------CDEACCIVYEYAS------------------SQYGSQRLDL---ALRVTRP-
GK311_Glam_PI3K  --------TDMDLAL-AHKVI------------------EHYYRVAMKE---ALYLNKP-


29569_Tthe_PI4K  T----------------------PFLETFSSQFNQSAT----------------------
13773_Tthe_PI4K  LLQFEDIIDSFCTNIEN---FFNSLFKIQESYLKSDGL----------------------
20618_Tthe_PI4K  SQSIANILLNFLKDQKITNNMIPELLKTF-SQLSSLGD----------------------
20619_Tthe_PI4K  SMTIATILLKFLKDSTITNNMIPELLKAF-SQLSALGD----------------------
n8_Tthe_PI4K     -----------------------N----KTFILKIEGY----------------------
n29_Tthe_PI4K    -----------------------Q----KFNPFQIYNFCENFSKI-QYLGFENLESIDFY
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   -----------------------N----LSFYLKMLWILQAYSDSCKLKSF-----KGWQ
n502_Tthe_PI4K   -----------------------S----INLYLLIYWSLDSFSESLKLDEA-----KKAE
n508_Tthe_PI4K   -----------------------S----ASFYFLVRSIVDAYSVNIKLDVD-----EQRN
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------TGSSIHRNQLK-------------------------------------
n737_Tthe_PI4K   -----------------------N----HQFILQVKGF----------------------
n858_Tthe_PI4K   -----------------------D----HQFILQIKGF----------------------
GK310_Glam_PI3K  ----------------------------YDLVIKQRGT----------------------
GK311_Glam_PI3K  ----------------------------HI--QKQLTA----------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ------------------------------------------------------------
20618_Tthe_PI4K  ------------------------------------------------------------
20619_Tthe_PI4K  ------------------------------------------------------------
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    DISRKTHKAITALSYSYKPSAEQLGAQYITNLKLRYIAKSIEQVVVR-SYNYEEISSLQF
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   -EHK--------------------------------------QICQQEFFLLLDTQRLHL
n502_Tthe_PI4K   -NE---------------------------------------------------------
n508_Tthe_PI4K   -LQ---------------------------------------------------------
n545_Tthe_PI4K   ------------------------------------------------------------
n679_Tthe_PI4K   ------------------------------------------------------------
n737_Tthe_PI4K   ------------------------------------------------------------
n858_Tthe_PI4K   ------------------------------------------------------------
GK310_Glam_PI3K  ------------------------------------------------------------
GK311_Glam_PI3K  ------------------------------------------------------------


29569_Tthe_PI4K  ------------------------------------------------------------
13773_Tthe_PI4K  ---------------------------------------L---MEILLDDAVDIDIQ---
20618_Tthe_PI4K  ---------------------------------------NTILL--YMDEIFPIFLQ---
20619_Tthe_PI4K  ---------------------------------------FQNLI--DMDEIFPIFLS---
n8_Tthe_PI4K     ------------------------------------------------------------
n29_Tthe_PI4K    NSKATLIDKRKQRMMNMLIQFQEIRNLNQSKSSLSEDHKY-ELI--SLENIVISFFKTFT
n73_Tthe_PI4K    ------------------------------------------------------------
n131_Tthe_PI4K   I------------------------QYQQKQK-LI--------------EM-------G-
n502_Tthe_PI4K   -------------------------RIKDLLK-TV--------