Protein (view, download) , Domain (view, download)
PKCz_Hsap_PKCi                    MPSRTGP---KME--------G--------------------------------------
PKCt_Hsap_PKCd                    MSPFLRI---G-------LSNFDC-G---------S--CQS-----------C-------
PKCi_Hsap_PKCi                    MPTQRDS---STM--------SH-----------TV--AG--------------------
PKCg_Hsap_PKCa                    MAGLGPG---V-------------------------------------------------
PKCh_Hsap_PKCh                    MSSGTMK---FNGYLRVRIGEAVGLQPTRWSLRHSL--FK------------K-------
PKCe_Hsap_PKCh                    MVVFN-------GLLKIKICEAVSLKPTAWSLRHAV--GPR-----------P-------
PKCd_Hsap_PKCd                    MAPFLRI---A-------FNSYEL-G---------S--LQA-------------------
PKCb_Hsap_PKCa                    MADPAAG---P-------------------------------------------------
PKCa_Hsap_PKCa                    MADVFPG---N-------------------------------------------------
Pkc53E_Dmel_PKCa                  MSEGSDN---NG-------------DPQQ-------------------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    MAAAAVA---TPG-------A-TVLPPSV-------------------------------
Pkc98E_Dmel_PKCh                  MFTG---------KLQIKVCEASGLRPTDFQKRHNLTFGKL-----------A-------
aPKC_Dmel_PKCi                    MPSQILN---DGS--------SV-----------SL--NS-----------AS-------
PKCz_Mmus_PKCi                    MPSRTDP---KMD--------R--------------------------------------
PKCt_Mmus_PKCd                    MSPFLRI---G-------LSNFDC-G---------T--CQA-----------C-------
PKCi_Mmus_PKCi                    MPTQRDS---STM--------SH-----------TV--AC--------------------
PKCg_Mmus_PKCa                    MAGLGPG---G-------------------------------------------------
PKCh_Mmus_PKCh                    MSSGTMK---FNGYLRVRIGEAVGLQPTRWSLRHSL--FK------------K-------
PKCe_Mmus_PKCh                    MVVFN-------GLLKIKICEAVSLKPTAWSLRHAV--GPR-----------P-------
PKCd_Mmus_PKCd                    MAPFLRI---S-------FNSYEL-G---------S--LQV-------------------
PKCb_Mmus_PKCa                    MADPAAG---P-------------------------------------------------
PKCa_Mmus_PKCa                    MADVYPA---N-------------------------------------------------
pkc-3_Cele_PKCi                   MSSPTSL---EED--------G--------------------------------------
pkc-2_Cele_PKCa                   MEVPQAQ---SLA-------AAALISPVK-------------------------------
kin-13_Cele_PKCh                  MLFT--------GTVRVRVLEARQLRPTEWSRRFRQ--D-E-----------A-------
PKC1_Scer_PKC-Unclassified        MSFSQLE---QNI--------KK-----------KI--AVEENIIRGASALKKKTSNVMV
tpa-1_Cele_PKCd                   MPEWFFL---I-------------------------------------------------
PKCa_Spur_PKCa                    MSDSS-------------------------------------------------------
PKCd_Spur_PKCd                    MVFL-RV---R-------VLQVDS-K---------E--IEL-----------P-------
PKCe_Spur_PKCh                    MAAE---------PPK--------------------------------------------
PKCi_Spur_PKCi                    MALHRAL---HIE--------NV-----------AV--CR-----------ER-------
CC1G_07190_Ccin_PKC-Unclassified  MSDFTER---KIL--------EA-----------TQ-------------HLRLATTNQDV
AqueK016_Aque_PKCa                MAEGSP------------------------------------------------------
AqueK017_Aque_PKCd                MSAFLRL---K-------LLKAEV-A-------------PA-----------P-------
AqueK018_Aque_PKCh                MAGAGGNPDTFTGLVSMTILEAQNLKSVTLPGGHK-----------------L-------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                MHFGCGR---FAA------FPCSFLPPFS-----AF--LS-----------RL-------


PKCz_Hsap_PKCi                    ------------------------------------------------------------
PKCt_Hsap_PKCd                    -----------------------------------Q--G---------------------
PKCi_Hsap_PKCi                    -----------------------------------G--GS--------------------
PKCg_Hsap_PKCa                    ------------------------------------------------------------
PKCh_Hsap_PKCh                    -----------------------------------G--H---------------------
PKCe_Hsap_PKCh                    -----------------------------------Q--T---------------------
PKCd_Hsap_PKCd                    -----------------------------------E--D---------------------
PKCb_Hsap_PKCa                    ------------------------------------------------------------
PKCa_Hsap_PKCa                    ------------------------------------------------------------
Pkc53E_Dmel_PKCa                  ------------------------------------------------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    ------------------------------------------------------------
Pkc98E_Dmel_PKCh                  -----------------------------------D--E---------------------
aPKC_Dmel_PKCi                    -----------------------------------M--NM--------------------
PKCz_Mmus_PKCi                    ------------------------------------------------------------
PKCt_Mmus_PKCd                    -----------------------------------Q--G---------------------
PKCi_Mmus_PKCi                    -----------------------------------G--GG--------------------
PKCg_Mmus_PKCa                    ------------------------------------------------------------
PKCh_Mmus_PKCh                    -----------------------------------G--H---------------------
PKCe_Mmus_PKCh                    -----------------------------------Q--T---------------------
PKCd_Mmus_PKCd                    -----------------------------------E--D---------------------
PKCb_Mmus_PKCa                    ------------------------------------------------------------
PKCa_Mmus_PKCa                    ------------------------------------------------------------
pkc-3_Cele_PKCi                   ------------------------------------------------------------
pkc-2_Cele_PKCa                   ------------------------------------------------------------
kin-13_Cele_PKCh                  -----------------------------------A--T---------------------
PKC1_Scer_PKC-Unclassified        IQKCNTNIREARQNLEYLEDSLKKLRLKTAQQS-QGENGSEDNERFNSKEYGFLST----
tpa-1_Cele_PKCd                   ------------------------------------------------------------
PKCa_Spur_PKCa                    ------------------------------------------------------------
PKCd_Spur_PKCd                    -----------------------------------G--S---------------------
PKCe_Spur_PKCh                    ------------------------------------------------------------
PKCi_Spur_PKCi                    -----------------------------------E--IE--------------------
CC1G_07190_Ccin_PKC-Unclassified  LKRNDAKVRETERSLAYLEGVLRELQTRKAQQMQQGDP-----SRFPSGPTPQVPPKDFD
AqueK016_Aque_PKCa                ------------------------------------------------------------
AqueK017_Aque_PKCd                -----------------------------------G--V---------------------
AqueK018_Aque_PKCh                -----------------------------------S--N---------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                -----------------------------------S--KM--------------------


PKCz_Hsap_PKCi                    ------------------------------------------------------------
PKCt_Hsap_PKCd                    ------------------------------------------------------------
PKCi_Hsap_PKCi                    ------------------------------------------------------------
PKCg_Hsap_PKCa                    ------------------------------------------------------------
PKCh_Hsap_PKCh                    ------------------------------------------------------------
PKCe_Hsap_PKCh                    ------------------------------------------------------------
PKCd_Hsap_PKCd                    ------------------------------------------------------------
PKCb_Hsap_PKCa                    ------------------------------------------------------------
PKCa_Hsap_PKCa                    ------------------------------------------------------------
Pkc53E_Dmel_PKCa                  ------------------------------------------------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    ------------------------------------------------------------
Pkc98E_Dmel_PKCh                  ------------------------------------------------------------
aPKC_Dmel_PKCi                    ------------------------------------------------------------
PKCz_Mmus_PKCi                    ------------------------------------------------------------
PKCt_Mmus_PKCd                    ------------------------------------------------------------
PKCi_Mmus_PKCi                    ------------------------------------------------------------
PKCg_Mmus_PKCa                    ------------------------------------------------------------
PKCh_Mmus_PKCh                    ------------------------------------------------------------
PKCe_Mmus_PKCh                    ------------------------------------------------------------
PKCd_Mmus_PKCd                    ------------------------------------------------------------
PKCb_Mmus_PKCa                    ------------------------------------------------------------
PKCa_Mmus_PKCa                    ------------------------------------------------------------
pkc-3_Cele_PKCi                   ------------------------------------------------------------
pkc-2_Cele_PKCa                   ------------------------------------------------------------
kin-13_Cele_PKCh                  ------------------------------------------------------------
PKC1_Scer_PKC-Unclassified        ----------KSPNEHIFSRLDLVKYDCPSLAQRIQYMLQQLEFKLQVEKQYQEANTKLT
tpa-1_Cele_PKCd                   ------------------------------------------------------------
PKCa_Spur_PKCa                    ------------------------------------------------------------
PKCd_Spur_PKCd                    ------------------------------------------------------------
PKCe_Spur_PKCh                    ------------------------------------------------------------
PKCi_Spur_PKCi                    ------------------------------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  GRGFSPDGTVARPQRKQYTNLDLIKADTPFTPRKISRTLHQLEFKLQVEKQYKLGIDKMA
AqueK016_Aque_PKCa                ------------------------------------------------------------
AqueK017_Aque_PKCd                ------------------------------------------------------------
AqueK018_Aque_PKCh                ------------------------------------------------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    ------------------------------------------------------------
PKCt_Hsap_PKCd                    ------------------------------------------------------------
PKCi_Hsap_PKCi                    ------------------------------------------------------------
PKCg_Hsap_PKCa                    ------------------------------------------------------------
PKCh_Hsap_PKCh                    ------------------------------------------------------------
PKCe_Hsap_PKCh                    ------------------------------------------------------------
PKCd_Hsap_PKCd                    ------------------------------------------------------------
PKCb_Hsap_PKCa                    ------------------------------------------------------------
PKCa_Hsap_PKCa                    ------------------------------------------------------------
Pkc53E_Dmel_PKCa                  ------------------------------------------------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    ------------------------------------------------------------
Pkc98E_Dmel_PKCh                  ------------------------------------------------------------
aPKC_Dmel_PKCi                    ------------------------------------------------------------
PKCz_Mmus_PKCi                    ------------------------------------------------------------
PKCt_Mmus_PKCd                    ------------------------------------------------------------
PKCi_Mmus_PKCi                    ------------------------------------------------------------
PKCg_Mmus_PKCa                    ------------------------------------------------------------
PKCh_Mmus_PKCh                    ------------------------------------------------------------
PKCe_Mmus_PKCh                    ------------------------------------------------------------
PKCd_Mmus_PKCd                    ------------------------------------------------------------
PKCb_Mmus_PKCa                    ------------------------------------------------------------
PKCa_Mmus_PKCa                    ------------------------------------------------------------
pkc-3_Cele_PKCi                   ------------------------------------------------------------
pkc-2_Cele_PKCa                   ------------------------------------------------------------
kin-13_Cele_PKCh                  ------------------------------------------------------------
PKC1_Scer_PKC-Unclassified        KLYQIDGDQRSSSAAEGGAMESKYRIQMLNKALKKYQAINVDFD--QFKHQPNDIMDNQQ
tpa-1_Cele_PKCd                   ------------------------------------------------------------
PKCa_Spur_PKCa                    ------------------------------------------------------------
PKCd_Spur_PKCd                    ------------------------------------------------------------
PKCe_Spur_PKCh                    ------------------------------------------------------------
PKCi_Spur_PKCi                    ------------------------------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  KLYQADGDKKSKADAEAKRIESDKKIQLLETALKRYRNLHVLDDVAEDDEQDTGTEGDRR
AqueK016_Aque_PKCa                ------------------------------------------------------------
AqueK017_Aque_PKCd                ------------------------------------------------------------
AqueK018_Aque_PKCh                ------------------------------------------------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    ------------------------------------------SGGRVRLK-------AH-
PKCt_Hsap_PKCd                    --------------------------------------EAVNPYCAVLVK-------EYV
PKCi_Hsap_PKCi                    ----------------------------------------GDHSHQVRVK-------AY-
PKCg_Hsap_PKCa                    ----------------------------------------------------G-D-----
PKCh_Hsap_PKCh                    --------------------------------------QLLDPYLTVSVD-------QV-
PKCe_Hsap_PKCh                    --------------------------------------FLLDPYIALNVD-------DS-
PKCd_Hsap_PKCd                    --------------------------------------EANQPFCAVKMK-------EAL
PKCb_Hsap_PKCa                    ----------------------------------------------------P-P-----
PKCa_Hsap_PKCa                    ----------------------------------------------------D-S-----
Pkc53E_Dmel_PKCa                  -------------------------------------------------QG-A-E--G--
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    ---------------------------------------------PSAAPGAKAPAAGAG
Pkc98E_Dmel_PKCh                  --------------------------------------QLIDPYVSIDVD-------ES-
aPKC_Dmel_PKCi                    ----------------------------------------ANTPNSITVK-------TA-
PKCz_Mmus_PKCi                    ------------------------------------------SGGRVRLK-------AH-
PKCt_Mmus_PKCd                    --------------------------------------EAVNPYCAVLVK-------EYV
PKCi_Mmus_PKCi                    ----------------------------------------GDHSHQVRVK-------AY-
PKCg_Mmus_PKCa                    ----------------------------------------------------G-D-----
PKCh_Mmus_PKCh                    --------------------------------------QLLDPYLTVSVD-------QV-
PKCe_Mmus_PKCh                    --------------------------------------FLLDPYIALNVD-------DS-
PKCd_Mmus_PKCd                    --------------------------------------EASQPFCAVKMK-------EAL
PKCb_Mmus_PKCa                    ----------------------------------------------------P-P-----
PKCa_Mmus_PKCa                    ----------------------------------------------------D-S-----
pkc-3_Cele_PKCi                   ---------------------------------------------DIKLK-------TR-
pkc-2_Cele_PKCa                   ----------------------------------------------------N-N--STG
kin-13_Cele_PKCh                  --------------------------------------AAIDSYVNVDWD-------EY-
PKC1_Scer_PKC-Unclassified        PKFRRKQLTGVLTIGITAARDVDHIQSPM-------FARKPESYVTIKID-------DT-
tpa-1_Cele_PKCd                   ------------------------------------------------------------
PKCa_Spur_PKCa                    ------------------------------------------------------------
PKCd_Spur_PKCd                    --------------------------------------VLFDPFVAVNVK-------ESV
PKCe_Spur_PKCh                    ------------------------------------------------------------
PKCi_Spur_PKCi                    ----------------------------------------ASM-HCIARR-------H--
CC1G_07190_Ccin_PKC-Unclassified  EKLRAKPLSGTLYVTVKGARELDH--APVVTRFRSSAKQVTETHVSIKAE-------GN-
AqueK016_Aque_PKCa                ------------------------------------------------------------
AqueK017_Aque_PKCd                --------------------------------------ARVDTFAAVSIK-------ETE
AqueK018_Aque_PKCh                --------------------------------------KDFDPYCVVDFD-------DI-
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ----------------------------------------GDDI--IPVR-------LS-


PKCz_Hsap_PKCi                    -----------------------------YGGDIF-ITS-VDAA--------------TT
PKCt_Hsap_PKCd                    ESENGQMYI-QKKPTMYPPWDSTFDA-HINKGRVMQIIVKGKN------VD-LIS-----
PKCi_Hsap_PKCi                    -----------------------------YRGDIM-ITH-FEPS--------------IS
PKCg_Hsap_PKCa                    ------------------------------------------------------------
PKCh_Hsap_PKCh                    --RVGQTS--TKQKTNKPTYNEEFCA-NVTDGGHLELAVFHETP--LGYDH-FVA-----
PKCe_Hsap_PKCh                    --RIGQTA--TKQKTNSPAWHDEFVT-DVCNGRKIELAVFHDAP--IGYDD-FVA-----
PKCd_Hsap_PKCd                    STERGKTLV-QKKPTMYPEWKSTFDA-HIYEGRVIQIVLMRAA------EE-PVS-----
PKCb_Hsap_PKCa                    ------------------------------------------------------------
PKCa_Hsap_PKCa                    ------------------------------------------------------------
Pkc53E_Dmel_PKCa                  ------------------------------------------------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    KG-----------------------------------------PG---------------
Pkc98E_Dmel_PKCh                  --HFDRAT--TRPKTFDPVWNEQFVH-DVTNVSNINLTVFHDAA--LPPDD-FVA-----
aPKC_Dmel_PKCi                    -----------------------------YNGQII-ITT-INKN--------------IS
PKCz_Mmus_PKCi                    -----------------------------YGGDIL-ITS-VDAM--------------TT
PKCt_Mmus_PKCd                    ESENGQMYI-QKKPTMYPPWDSTFDA-HINKGRVMQIIVKGKN------VD-LIS-----
PKCi_Mmus_PKCi                    -----------------------------YRGDIM-ITH-FEPS--------------IS
PKCg_Mmus_PKCa                    ------------------------------------------------------------
PKCh_Mmus_PKCh                    --RVGQTS--TKQKTNKPTYNEEFCA-NVTDGGHLELAVFHETP--LGYDH-FVA-----
PKCe_Mmus_PKCh                    --RIGQTA--TKQKTNSPAWHDEFVT-DVCNGRKIELAVFHDAP--IGYDD-FVA-----
PKCd_Mmus_PKCd                    STERGKTLV-QKKPTMYPEWKTTFDA-HIYEGRVIQIVLMRAA------ED-PVS-----
PKCb_Mmus_PKCa                    ------------------------------------------------------------
PKCa_Mmus_PKCa                    ------------------------------------------------------------
pkc-3_Cele_PKCi                   -----------------------------FQGQVV-VLY-ARPP--------------LI
pkc-2_Cele_PKCa                   GGGNQQLC--IRKS--------------ISNPSSLKVYAHHEAPGIIHFPR-FEF-----
kin-13_Cele_PKCh                  --HIGKTQ--VRPKTNEPRWNEEFTASGVHQGKAIGFSVFHSCV--MPPDD-FVA-----
PKC1_Scer_PKC-Unclassified        --I---KA--RTKPSRNDRWSEDFQI-PVEKGNEIEITVYDKVN--DSL--IPVAIMWLL
tpa-1_Cele_PKCd                   ------------------------------------------------------------
PKCa_Spur_PKCa                    ------------------------------------------------------------
PKCd_Spur_PKCd                    KDANGQTQLRQKRKTAFVEWNKCFDS-HLYDGRVIQVIVYNRP------ES-YLA-----
PKCe_Spur_PKCh                    ------------------------------------------------------------
PKCi_Spur_PKCi                    ------------------------------------TT----A-----------------
CC1G_07190_Ccin_PKC-Unclassified  --Q---LA--RSHPSRTDRWNEDFEI-AVEKANEIEIVLYDKQV--SEPHAVPIGLLWIK
AqueK016_Aque_PKCa                ------------------------------------------------------------
AqueK017_Aque_PKCd                QSPQGPVLV-QKKKTFYPEWGKCFDS-HLVTGRRMMVEVMDRAS----PET-KIA-----
AqueK018_Aque_PKCh                --YFGKTT--HKTNTYCPVWNELVEE-PVEDASRMQIALFHAST--IPPNP-FIA-----
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                -----------------------------FRGKDI-KFS-LVPN--------------LA


PKCz_Hsap_PKCi                    FEELCEEVRD-------------------------------------------------M
PKCt_Hsap_PKCd                    ---------------------------------------------------ETTVELYSL
PKCi_Hsap_PKCi                    FEGLCNEVRD-------------------------------------------------M
PKCg_Hsap_PKCa                    ------------------------------------------------------------
PKCh_Hsap_PKCh                    ---------------------------------------------------NCTLQFQEL
PKCe_Hsap_PKCh                    ---------------------------------------------------NCTIQFEEL
PKCd_Hsap_PKCd                    ---------------------------------------------------EVTVGVSVL
PKCb_Hsap_PKCa                    ------------------------------------------------------------
PKCa_Hsap_PKCa                    ------------------------------------------------------------
Pkc53E_Dmel_PKCa                  ------------------------------------------------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    ------------------------------------------------------------
Pkc98E_Dmel_PKCh                  ---------------------------------------------------NCIISFEDL
aPKC_Dmel_PKCi                    YEELCYEIRN-------------------------------------------------I
PKCz_Mmus_PKCi                    FKDLCEEVRD-------------------------------------------------M
PKCt_Mmus_PKCd                    ---------------------------------------------------ETTVELYSL
PKCi_Mmus_PKCi                    FEGLCSEVRD-------------------------------------------------M
PKCg_Mmus_PKCa                    ------------------------------------------------------------
PKCh_Mmus_PKCh                    ---------------------------------------------------NCTLQFQEL
PKCe_Mmus_PKCh                    ---------------------------------------------------NCTIQFEEL
PKCd_Mmus_PKCd                    ---------------------------------------------------EVTVGVSVL
PKCb_Mmus_PKCa                    ------------------------------------------------------------
PKCa_Mmus_PKCa                    ------------------------------------------------------------
pkc-3_Cele_PKCi                   LDDFFALLKD-------------------------------------------------A
pkc-2_Cele_PKCa                   ---------------------------------------------------SHRLSIRPL
kin-13_Cele_PKCh                  ---------------------------------------------------NTRIAFDQL
PKC1_Scer_PKC-Unclassified        LSDIAEEIRKKKAGQTNEQQGWVNASNINGG----SSLASEEGSTLTSTYSNSAIQSTSA
tpa-1_Cele_PKCd                   ------------------------------------------------------------
PKCa_Spur_PKCa                    ------------------------------------------------------------
PKCd_Spur_PKCd                    ---------------------------------------------------EANYKVNEL
PKCe_Spur_PKCh                    ------------------------------------------------------------
PKCi_Spur_PKCi                    ------------------------------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  ITDLVDALRRQKIGQESQ-GGWVTANAMHGDGPMGPGGIHHHPSQPITGDINAPIAFQDN
AqueK016_Aque_PKCa                ------------------------------------------------------------
AqueK017_Aque_PKCd                ---------------------------------------------------EMVVETEEL
AqueK018_Aque_PKCh                ---------------------------------------------------HVQVPVSEI
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                VTDVSNEIRK-------------------------------------------------Q


PKCz_Hsap_PKCi                    ---CRL-----HQQHPLTLKWVDSEGDPCTVS--SQMELEEAFRLARQCRDEGLIIHVFP
PKCt_Hsap_PKCd                    AERCR----KN---NGKTEIWLELKPQ--------------------------GRMLMNA
PKCi_Hsap_PKCi                    ---CSF-----DNEQLFTMKWIDEEGDPCTVS--SQLELEEAFRLYELNKDSELLIHVFP
PKCg_Hsap_PKCa                    ------------------------------------------------------------
PKCh_Hsap_PKCh                    ---LR----TT-GASDTFEGWVDLEPE--------------------------GKVFVVI
PKCe_Hsap_PKCh                    ---LQ----N---GSRHFEDWIDLEPE--------------------------GRVYVII
PKCd_Hsap_PKCd                    AERCK----KN---NGKAEFWLDLQPQ--------------------------AKVLMSV
PKCb_Hsap_PKCa                    ------------------------------------------------------------
PKCa_Hsap_PKCa                    ------------------------------------------------------------
Pkc53E_Dmel_PKCa                  ------------------------------------------------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    ------------------------------------------------------------
Pkc98E_Dmel_PKCh                  ---MQ----S---ETAVQDLWVNLEPQ--------------------------GKIHVII
aPKC_Dmel_PKCi                    ---CRF-----PLDQPFTIKWVDEENDPCTIS--TKMELDEAIRLYEMNFDSQLVIHVFP
PKCz_Mmus_PKCi                    ---CGL-----HQQHPLTLKWVDSEGDPCTVS--SQMELEEAFRLVCQGRDEVLIIHVFP
PKCt_Mmus_PKCd                    AERCR----KN---NGRTEIWLELKPQ--------------------------GRMLMNA
PKCi_Mmus_PKCi                    ---CSF-----DNEQPFTMKWIDEEGDPCTVS--SQLELEEAFRLYELNKDSELLIHVFP
PKCg_Mmus_PKCa                    ------------------------------------------------------------
PKCh_Mmus_PKCh                    ---LR----TA-GTSDTFEGWVDLEPE--------------------------GKVFVVI
PKCe_Mmus_PKCh                    ---LQ----N---GSRHFEDWIDLEPE--------------------------GKVYVII
PKCd_Mmus_PKCd                    AERCK----KN---NGKAEFWLDLQPQ--------------------------AKVLMCV
PKCb_Mmus_PKCa                    ------------------------------------------------------------
PKCa_Mmus_PKCa                    ------------------------------------------------------------
pkc-3_Cele_PKCi                   ---CKQ-----HKKQDITVKWIDEDGDPISID--SQMELDEAVRCLNSSQEAELNIHVFV
pkc-2_Cele_PKCa                   ---LK-------------------------------------------------------
kin-13_Cele_PKCh                  ----K----I----GSANDIWVDLEPH--------------------------GQLHVVV
PKC1_Scer_PKC-Unclassified        ---KNVQGENTSTSQISTNSWFVLEPS--------------------------GQILLTL
tpa-1_Cele_PKCd                   -------------------------PQ--------------------------LQFHNKS
PKCa_Spur_PKCa                    ------------------------------------------------------------
PKCd_Spur_PKCd                    AAMCG----MD---GRIETKWLDLMPY--------------------------GRLQVQL
PKCe_Spur_PKCh                    ------------------------------------------------------------
PKCi_Spur_PKCi                    -------------TTSCSRSWSRRTNIPACTS--RHQACFSCNRCSLSS--STGKWRVFP
CC1G_07190_Ccin_PKC-Unclassified  ---LSASGHG-ASHTEGIEAWFSVEPA--------------------------GAIALQL
AqueK016_Aque_PKCa                ------------------------------------------------------------
AqueK017_Aque_PKCd                SSICK----EEPDPSSAINLALDLRPK--------------------------GKLILQV
AqueK018_Aque_PKCh                ---R-----LT----KEDEFTLELEPE--------------------------GSIRFRI
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ---CGL-----HSAAPFNLKYLDVENDPVSVSLDRQREWDEAIRLFFYNEEKELQLHVFE


PKCz_Hsap_PKCi                    STPEQPGL-P---CPG-----------E-----D--KSIYRRGAR--RWR--KLYRANGH
PKCt_Hsap_PKCd                    RYFLEMSD-T--------------KDMNEFETEGFFALHQRRGAI--KQA--KVHHVKCH
PKCi_Hsap_PKCi                    CVPERPGM-P---CPG-----------E-----D--KSIYRRGAR--RWR--KLYCANGH
PKCg_Hsap_PKCa                    -------------SEG-----------G------PRPLFCRKGAL--RQK--VVHEVKSH
PKCh_Hsap_PKCh                    TLTGSFTE-A--TL-Q-----------RDRIF--KHFTRKRQRAM--R-R--RVHQINGH
PKCe_Hsap_PKCh                    DLSGSSGE-A--PKDN-----------EERVFRERMRPRKRQGAV--R-R--RVHQVNGH
PKCd_Hsap_PKCd                    QYFLEDVD-C--------------KQSMRSEDEAKFPTMNRRGAI--KQA--KIHYIKNH
PKCb_Hsap_PKCa                    -------------SEG-----------E-----ESTVRFARKGAL--RQK--NVHEVKNH
PKCa_Hsap_PKCa                    -------------TAS-----------Q-----DVANRFARKGAL--RQK--NVHEVKDH
Pkc53E_Dmel_PKCa                  -------E-----AVG-----------E-----NKMKSRLRKGAL--KKK--NVFNVKDH
PKCdelta_Dmel_PKCd                ---------------------------------------NRRGAI--KHQ--KTHDINGH
inaC_Dmel_PKCa                    -------NLL--EITG-----------EAN-IVNYMKNRLRKGAM--KRK--GLEMVNGH
Pkc98E_Dmel_PKCh                  ELKNRTDK-A--KAEA----VVEHTVAVNKEFKERAGFNRRRGAM--R-R--RVHQVNGH
aPKC_Dmel_PKCi                    NVPQAPGL-S---CDG-----------E-----D--RSIYRRGAR--RWR--KLYRVNGH
PKCz_Mmus_PKCi                    SIPEQPGM-P---CPG-----------E-----D--KSIYRRGAR--RWR--KLYRANGH
PKCt_Mmus_PKCd                    RYFLEMSD-T--------------KDMSEFENEGFFALHQRRGAI--KQA--KVHHVKCH
PKCi_Mmus_PKCi                    CVPERPGM-P---CPG-----------E-----D--KSIYRRGAR--RWR--KLYCANGH
PKCg_Mmus_PKCa                    -------------SEG-----------G------PRPLFCRKGAL--RQK--VVHEVKSH
PKCh_Mmus_PKCh                    TLTGSFTE-A--TL-Q-----------RDRIF--KHFTRKRQRAM--R-R--RVHQVNGH
PKCe_Mmus_PKCh                    DLSGSSGE-A--PKDN-----------EERVFRERMRPRKRQGAV--R-R--RVHQVNGH
PKCd_Mmus_PKCd                    QYFLEDGD-C--------------KQSMRSEEEAKFPTMNRRGAI--KQA--KIHYIKNH
PKCb_Mmus_PKCa                    -------------SEG-----------E-----ESTVRFARKGAL--RQK--NVHEVKNH
PKCa_Mmus_PKCa                    -------------TAS-----------Q-----DVANRFARKGAL--RQK--NVHEVKDH
pkc-3_Cele_PKCi                   GKPELPGL-P---CQG-----------E-----D--KTVYRRGAR--RWK--KIYLYNGH
pkc-2_Cele_PKCa                   ----RLHE-----QAQ-----------R-----IEGKAFVRRGAL--RQK--NVHEIKSH
kin-13_Cele_PKCh                  EMHGTNVEDV--HSHN--------KTRVFKERTNAFNDRQRRGAM--R-R--KIHEVTGH
PKC1_Scer_PKC-Unclassified        GFHKSSQI-E---RKQ-----------L-------MGGLHRHGAI--INRKEEIFEQHGH
tpa-1_Cele_PKCd                   KKVSDDD----HPV----------EDIMTSRSNSGPGIQRRRGAI--KHA--RVHEIRGH
PKCa_Spur_PKCa                    ---------------------------------FEMKGFARRGAL--RQK--NVYEIKNH
PKCd_Spur_PKCd                    RCFPEEGG-GGDPMNSVRSTVSHHNSDMDKKDDTTGLLTKRRVAI--RKA--KVHEHRGH
PKCe_Spur_PKCh                    --------------EK------------VFRVRE-NAVHKRRGAV--R-R--RVHQVNGH
PKCi_Spur_PKCi                    TVPVRPGL-P---CPG-----------E-----D--RNIYRRGAR--RWR--KLYKVNGH
CC1G_07190_Ccin_PKC-Unclassified  NFVKENVR-K-RPFDA-----------P-------LGGLGRQGAV--RKRKGDVHEMNGH
AqueK016_Aque_PKCa                -----------------------------------VRRPKRRNAV--KQG--KVVEIKGH
AqueK017_Aque_PKCd                KLYGQTSD-C--PADRT-------PEHLESLPKNATALRGRRNAIHLRQL--SVCERKGH
AqueK018_Aque_PKCh                QFQEKWGS-L--AK-K-----------E-FHVR-SQVIKGHRGAV--R-R--KIHIVNAH
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                GPPPKPGE-L---CEG-----------E-----D-TRVYHRRGAR--RWR--KVRRINGH


PKCz_Hsap_PKCi                    LFQAKRFNRRAYCGQCSERIWG-LARQGYRCINCKLLVHKRCHGLVPLT--CRKHMDSVM
PKCt_Hsap_PKCd                    EFTATFFPQPTFCSVCHEFVWGL-NKQGYQCRQCNAAIHKKCIDKVIAK--CTGSAINSR
PKCi_Hsap_PKCi                    TFQAKRFNRRAHCAICTDRIWG-LGRQGYKCINCKLLVHKKCHKLVTIE--CGRHSLPQE
PKCg_Hsap_PKCa                    KFTARFFKQPTFCSHCTDFIWG-IGKQGLQCQVCSFVVHRRCHEFVTFE--CPGAGKGPQ
PKCh_Hsap_PKCh                    KFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTA--CTCQNNINK
PKCe_Hsap_PKCh                    KFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITK--CAGLKKQET
PKCd_Hsap_PKCd                    EFIATFFGQPTFCSVCKDFVWGL-NKQGYKCRQCNAAIHKKCIDKIIGR--CTGTAANSR
PKCb_Hsap_PKCa                    KFTARFFKQPTFCSHCTDFIWG-FGKQGFQCQVCCFVVHKRCHEFVTFS--CPGADKGPA
PKCa_Hsap_PKCa                    KFIARFFKQPTFCSHCTDFIWG-FGKQGFQCQVCCFVVHKRCHEFVTFS--CPGADKGPD
Pkc53E_Dmel_PKCa                  CFIARFFKQPTFCSHCKDFIWG-FGKQGFQCQVCSYVVHKRCHEYVTFI--CPGKDKGID
PKCdelta_Dmel_PKCd                RFVAKFFRQPTFCAFCNLFLWGF-GKQGYQCIICQTVVHKKCHDKLLGK--CSGSVFTSA
inaC_Dmel_PKCa                    RFGVRFFKNPTYCGHCKDFIWG-FGKQGFQCEECRFNIHQKCCKFVVFK--CPGKDTDFD
Pkc98E_Dmel_PKCh                  KFMATFLRQPTFCSHCREFIWG-IGKQGYQCQVCTLVVHKKCHLSVVSK--CPGMRDEQP
aPKC_Dmel_PKCi                    IFQAKRFNRRAFCAYCQDRIWG-LGRQGFKCIQCKLLVHKKCHKLVQKH--CTDQPEPLV
PKCz_Mmus_PKCi                    LFQAKRFNRGAYCGQCSERIWG-LSRQGYRCINCKLLVHKRCHVLVPLT--CRRHMDSVM
PKCt_Mmus_PKCd                    EFTATFFPQPTFCSVCHEFVWGL-NKQGYQCRQCNAAIHKKCIDKVIAK--CTGSAINSR
PKCi_Mmus_PKCi                    TFQAKRFNRRAHCAICTDRIWG-LGRQGYKCINCKLLVHKKCHKLVTIE--CGRHSLPPE
PKCg_Mmus_PKCa                    KFTARFFKQPTFCSHCTDFIWG-IGKQGLQCQVCSFVVHRRCHEFVTFE--CPGAGKGPQ
PKCh_Mmus_PKCh                    KFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTA--CTCQNNINK
PKCe_Mmus_PKCh                    KFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITK--CAGLKKQET
PKCd_Mmus_PKCd                    EFIATFFGQPTFCSVCKEFVWGL-NKQGYKCRQCNAAIHKKCIDKIIGR--CTGTATNSR
PKCb_Mmus_PKCa                    KFTARFFKQPTFCSHCTDFIWG-FGKQGFQCQVCCFVVHKRCHEFVTFS--CPGADKGPA
PKCa_Mmus_PKCa                    KFIARFFKQPTFCSHCTDFIWG-FGKQGFQCQVCCFVVHKRCHEFVTFS--CPGADKGPD
pkc-3_Cele_PKCi                   RFQAKRLNRRIQCFICHDYIWG-IGRQGFRCVDCRLCVHKKCHRHVRTH--CGQALQGPN
pkc-2_Cele_PKCa                   KFIARFFKQPTFCSHCKDFLWG-ITKQGFQCQVCTLVVHKRCHEFVNFA--CPGADKGVD
kin-13_Cele_PKCh                  KFMALFLRQPTFCAHCKEFIWG-IGKQGYQCQICTVVVHKRCHEDVVWK--CPGNKADAV
PKC1_Scer_PKC-Unclassified        HFVQKSFYNIMCCAYCGDFL----RYTGFQCQDCKFLCHKKCYTNVVTK--CIAKTSTDT
tpa-1_Cele_PKCd                   QFVATFFRQPHFCSLCSDFMWGL-NKQGYQCQLCSAAVHKKCHEKVIMQ--CPGSAKNTK
PKCa_Spur_PKCa                    KFIPRFFKQPTFCSHCKDFIWG-FGKQGFQCTVCSFVVHKRCHEFVTFM--CPGIDHGAD
PKCd_Spur_PKCd                    KFTPHYFRTPAYCSYCNEFIWGLVGTQGYRCMECELSVHKRCFNQVLGK--CPGTGVNST
PKCe_Spur_PKCh                    KFMSTFLRQPTFCSHCQDFIWG-LYRQGYQCQVCTVVVHKRCHEQIITR--CPGHKDEGV
PKCi_Spur_PKCi                    TFQPKRFSRRALCTYCADRIWG-LGRQGYKCVDCKLLVHKKCHRLVKVS--CAERQANLS
CC1G_07190_Ccin_PKC-Unclassified  KFIQRQFYQLMKCAFCGDFL---LNAAGYQCEDCRYTCHQKCYEKVVTK--CISKSSTGE
AqueK016_Aque_PKCa                KFVLTYFKQFTFCGHCTRFLWGLTGPQGYRCLSCDFTIHRRCLEYVSFI--CPGTSLPAG
AqueK017_Aque_PKCd                RFVKKFFRQPVYCSYCHEFLWGF-TKPGFQCQVCAYTSHVKCVESIIAN--CTGATVHAT
AqueK018_Aque_PKCh                KFMATYLRQFTFCAHCRDFIWGLVNKQGYQCQVCSMVVHKRCHKSIITP--CTGRKITED
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                AFVAKRL-QAAYCAKCRERIWG-LGRQGYKCEACKMVVHKRCCYYLNKDEICAGHPPAKQ


PKCz_Hsap_PKCi                    PSQEP----PVDDKNEDADLPSE-------------------------------------
PKCt_Hsap_PKCd                    ET------MFH-KERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVH
PKCi_Hsap_PKCi                    P--VM----PMDQSSMHSDH----------------------------------------
PKCg_Hsap_PKCa                    TDDP--------------RNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVH
PKCh_Hsap_PKCh                    VDSK-----IA-EQRFGINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVH
PKCe_Hsap_PKCh                    -PDQ-----VG-SQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVH
PKCd_Hsap_PKCd                    DT------IFQ-KERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVH
PKCb_Hsap_PKCa                    SDDP--------------RSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVH
PKCa_Hsap_PKCa                    TDDP--------------RSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVH
Pkc53E_Dmel_PKCa                  SDSP--------------KTQHNFEPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVH
PKCdelta_Dmel_PKCd                ST------ILL-RERFKIDMPHRFKPHTFMSPTFCDHCGSLMGGFFIQGLKCEECDVNCH
inaC_Dmel_PKCa                    ADCA--------------KVKHGWISTTYTTPTFCDECGLLLHGVAHQGVKCENCNLNVH
Pkc98E_Dmel_PKCh                  AKVEM---VPA-GQRFNVNLPHRFVVHSYKRFTFCDHCGSLLYGLIKQGLQCETCGMNVH
aPKC_Dmel_PKCi                    K--ER----AE-ESSDPIPVPLP-------------------------------------
PKCz_Mmus_PKCi                    PSQEP----PVDDKNDGVDLPSE-------------------------------------
PKCt_Mmus_PKCd                    ET------MFH-KERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVH
PKCi_Mmus_PKCi                    P--MM----PMDQT-MHPDH----------------------------------------
PKCg_Mmus_PKCa                    TDDP--------------RNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVH
PKCh_Mmus_PKCh                    VDAK-----IA-EQRFGINIPHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVH
PKCe_Mmus_PKCh                    -PDE-----VG-SQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVH
PKCd_Mmus_PKCd                    DT------IFQ-KERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVH
PKCb_Mmus_PKCa                    SDDP--------------RSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVH
PKCa_Mmus_PKCa                    TDDP--------------RSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVH
pkc-3_Cele_PKCi                   ---II----PMAPASGS-------------------------------------------
pkc-2_Cele_PKCa                   TDDP--------------RQQHKWKVQTYSSPTFCDHCGSLLYGILHQGMKCQSCDTNVH
kin-13_Cele_PKCh                  EELGKEIQETG-AGRFNINMPHRFSVHSYKRPTFCDHCGSMLYGLINQGLQCSTCKLNVH
PKC1_Scer_PKC-Unclassified        D--PD----EA---KLNHRIPHRFLPTSNRGTKWCCHCGYILPWGRHKVRKCSECGIMCH
tpa-1_Cele_PKCd                   ET------MAL-KERFKVDIPHRFKTYNFKSPTFCDHCGSMLYGLFKQGLRCEVCNVACH
PKCa_Spur_PKCa                    TDDP--------------RNKHKFEVNSYNSPTFCDHCGSLLYGLYHQGMRCGACNMNVH
PKCd_Spur_PKCd                    ET------KKL-KERFNINMPHRFKVNNYKSPTFCDHC---------------VCNVNVH
PKCe_Spur_PKCh                    ND-Q-----VG-SQRFNINIPHRFSLHNFRRPTFCDHCGSLLYGLFKQGVQCEVCKMNVH
PKCi_Spur_PKCi                    T--LD----ER-SG--SGSLPHF-------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  D--ED---------KINHRIPHRFESITNIGANWCCHCGYMLPFGRKNARRCTECDITCH
AqueK016_Aque_PKCa                -LEP---------------RPHTFKTASFYHPTFCAHCGSMIYGLFNQGVRCSDCGMTAH
AqueK017_Aque_PKCd                LS------KNL-KERFKIDMPHRFKPHSFLRPTFCDHCGQLMRGLFRQGVKCGVCGVNCH
AqueK018_Aque_PKCh                EDTA-----KA-SARFSINVPHRFKVHNYKRPTFCSHCGSLLWGLYRQGLKCEACAINVH
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                PEE--------SDK----------------------------------------------


PKCz_Hsap_PKCi                    ------------------------------------ETD--------GI-----------
PKCt_Hsap_PKCd                    HRCQTKVANLCGINQKLMAEALA-MIES----TQ--------------------QA----
PKCi_Hsap_PKCi                    -------------------------------------AQ--------TV-----------
PKCg_Hsap_PKCa                    RRCVRSVPSLCGVDHTERRGRLQLEIRA---PTA--------------------DEIHVT
PKCh_Hsap_PKCh                    IRCQANVAPNCGVNAVELAKTL--------------------------------------
PKCe_Hsap_PKCh                    RRCETNVAPNCGVDARGIAKVL--------------------------------------
PKCd_Hsap_PKCd                    HKCREKVANLCGINQKLLAEALN-QVTQ----RA--------------------SR----
PKCb_Hsap_PKCa                    KRCVMNVPSLCGTDHTERRGRIYIQAHI----DR--------------------DVLIVL
PKCa_Hsap_PKCa                    KQCVINVPSLCGMDHTEKRGRIYLKAEV----AD--------------------EKLHVT
Pkc53E_Dmel_PKCa                  ARCKENVPSLCGCDHTERRGRIYLEINV----KE--------------------NLLTVQ
PKCdelta_Dmel_PKCd                KKCERLTANLCGVNQKLIVEALN-HVKR----ET--------------------SY----
inaC_Dmel_PKCa                    HACQETVPPMCGADISEVRGKLLLYVEL----KG--------------------NNLKVD
Pkc98E_Dmel_PKCh                  KRCQKNVANTCGINTKQMAEIL--------------------------------------
aPKC_Dmel_PKCi                    ---------------------------P----LPYE------------------------
PKCz_Mmus_PKCi                    ------------------------------------ETD--------GI-----------
PKCt_Mmus_PKCd                    HRCQTKVANLCGINQKLMAEALA-MIES----TQ--------------------QA----
PKCi_Mmus_PKCi                    -------------------------------------TQ--------TV-----------
PKCg_Mmus_PKCa                    RRCVRSVPSLCGVDHTERRGRLQLEIRA---PTS--------------------DEIHIT
PKCh_Mmus_PKCh                    IRCQANVAPNCGVNAVELAKTL--------------------------------------
PKCe_Mmus_PKCh                    RRCETNVAPNCGVDARGIAKVL--------------------------------------
PKCd_Mmus_PKCd                    HKCREKVANLCGINQKLLAEALN-QVTQ----RS--------------------SR----
PKCb_Mmus_PKCa                    KRCVMNVPSLCGTDHTERRGRIYIQAHI----DR--------------------EVLIVV
PKCa_Mmus_PKCa                    KQCVINVPSLCGMDHTEKRGRIYLKAEV----TD--------------------EKLHVT
pkc-3_Cele_PKCi                   --------------------------------LKGARSNTSSSTTR-SG-----------
pkc-2_Cele_PKCa                   HRCVKNVPNMCGTDNTEKRGRLRIEAHI----EN--------------------DQLTIK
kin-13_Cele_PKCh                  KRCQRNVANNCGINAKQMAAEL--------------------------------------
PKC1_Scer_PKC-Unclassified        AQCAHLVPDFCGMSMEMANKILK-TIQD----TKRN---QEKK-KR-TVPS---AQLGSS
tpa-1_Cele_PKCd                   HKCERLMSNLCGVNQKQLSEMYH-EIKR----GT--------------------HA----
PKCa_Spur_PKCa                    KRCQKSVPNLCGADHTERRGRIRLKAEV----TE--------------------NKLKVT
PKCd_Spur_PKCd                    HKCKNNVPNLCGVNQRLLSEALS-SIEK----DK--------------------------
PKCe_Spur_PKCh                    KRCSRNVANNCGVNNKEMADIL--------------------------------------
PKCi_Spur_PKCi                    --------------------------GS----KPGDRSDS----HH-KR-----------
CC1G_07190_Ccin_PKC-Unclassified  ANCAHLVPDFCGMRMEVANELLR-SMQD----IKRR---REDR-EQRRPPTHQPEQLHTS
AqueK016_Aque_PKCa                HRCQALVPRACGQDTQEKRGRIKVGFYTQRSTENN-------------------WRINIE
AqueK017_Aque_PKCd                SRCQPNIPNLCGVNERLMAEALK-DVDE----VK--------------------KK----
AqueK018_Aque_PKCh                QRCEQFVAHSCGIDQVSLAKMM--------------------------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    -----------------------------AYI-----------------S-SSR--KHD-
PKCt_Hsap_PKCd                    -----------------RCLRDTE---QIFREGPVEI---------GLPC-SIK--NEAR
PKCi_Hsap_PKCi                    -----------------------------IPY-------------------NPS--SHE-
PKCg_Hsap_PKCa                    ------------VGEARN----------LIPMDPNGL--SDPYVKLKLIP-DPR--NLTK
PKCh_Hsap_PKCh                    -------------------------------------------AGMGLQP-GNI--SPTS
PKCe_Hsap_PKCh                    -------------------------------------------ADLGVTP-DKI--TNSG
PKCd_Hsap_PKCd                    -----------------RSDSASS--------EPVGI-----------------------
PKCb_Hsap_PKCa                    ------------VRDAKN----------LVPMDPNGL--SDPYVKLKLIP-DPK--SESK
PKCa_Hsap_PKCa                    ------------VRDAKN----------LIPMDPNGL--SDPYVKLKLIP-DPK--NESK
Pkc53E_Dmel_PKCa                  ------------IKEGRN----------LIPMDPNGL--SDPYVKVKLIP-DDK--DQSK
PKCdelta_Dmel_PKCd                -----------------TY-SQ-------------------------------------F
inaC_Dmel_PKCa                    ------------IKEAAN----------LIPMDTNGF--SDPYIAVQMHP-DRS--GRTK
Pkc98E_Dmel_PKCh                  -------------------------------------------SSLGISP-DKQ--QPRR
aPKC_Dmel_PKCi                    -----------------------------AMS-----------------G-GA---EAC-
PKCz_Mmus_PKCi                    -----------------------------AYI-----------------S-SSR--KHD-
PKCt_Mmus_PKCd                    -----------------RSLRDSE---HIFREGPVEI---------GLPC-STK--NETR
PKCi_Mmus_PKCi                    -----------------------------IPY-------------------NPS--SHE-
PKCg_Mmus_PKCa                    ------------VGEARN----------LIPMDPNGL--SDPYVKLKLIP-DPR--NLTK
PKCh_Mmus_PKCh                    -------------------------------------------AGMGLQP-GNI--SPTS
PKCe_Mmus_PKCh                    -------------------------------------------ADLGVTP-DKI--TNSG
PKCd_Mmus_PKCd                    -----------------KLDT--T--------ESVGI-----------------------
PKCb_Mmus_PKCa                    ------------VRDAKN----------LVPMDPNGL--SDPYVKLKLIP-DPK--SESK
PKCa_Mmus_PKCa                    ------------VRDAKN----------LIPMDPNGL--SDPYVKLKLIP-DPK--NESK
pkc-3_Cele_PKCi                   -----------------------------GGI-----------------D-NGA--FHE-
pkc-2_Cele_PKCa                   ------------ILEAKN----------LIPMDPNGL--SDPYVKCKLIP-EDSG-CKSK
kin-13_Cele_PKCh                  -------------------------------------------AQLGLTG-DKM--SIRS
PKC1_Scer_PKC-Unclassified        ------------IGTA-N----------GSDLSPSKL--AER-ANAPLPP-QPR--KHDK
tpa-1_Cele_PKCd                   -----------------TA-SCPP---NIANLHLNG---------------------ETS
PKCa_Spur_PKCa                    ------------VEEAKN----------LIPMDPNGL--SDPFVKLKLIP-DQK--NQTK
PKCd_Spur_PKCd                    -----------------KLPP--G--------AGNGK-----------------------
PKCe_Spur_PKCh                    -------------------------------------------REMGVTG-DKL--SIKR
PKCi_Spur_PKCi                    -----------------------------SKS-----------------G-SPR--HRR-
CC1G_07190_Ccin_PKC-Unclassified  TPSLDARLGQMTLGGPPQ----------HEPGPPAQLPSSDPFGRQMPMP-APQ--TYGP
AqueK016_Aque_PKCa                ------------IIECRN----------LPPMDPNGL--ADPFVKVSLLDSDGKDKSSMK
AqueK017_Aque_PKCd                -----------------RLSSSSSAGSVVSPKGGAGA-----------I---GG--AAPK
AqueK018_Aque_PKCh                -------------------------------------------SQMGVSA-DQL--SLSG
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    ------------------------------------------------------------
PKCt_Hsap_PKCd                    --PPCLP---TP-G----------------------------------------------
PKCi_Hsap_PKCi                    ------------------------------------------------------------
PKCg_Hsap_PKCa                    QKTRTV----K--A----------------------------------------------
PKCh_Hsap_PKCh                    KLVSR--------S----------------------------------------------
PKCe_Hsap_PKCh                    QRRKKL----I--A----------------------------------------------
PKCd_Hsap_PKCd                    ----------YQ-G----------------------------------------------
PKCb_Hsap_PKCa                    QKTKTI----K--C----------------------------------------------
PKCa_Hsap_PKCa                    QKTKTI----R--S----------------------------------------------
Pkc53E_Dmel_PKCa                  KKTRTI----K--A----------------------------------------------
PKCdelta_Dmel_PKCd                QKSG--------------------------------------------------------
inaC_Dmel_PKCa                    KKTKTI----Q--K----------------------------------------------
Pkc98E_Dmel_PKCh                  SKYL-N----Q--Q----------------------------------------------
aPKC_Dmel_PKCi                    ------------------------------------------------------------
PKCz_Mmus_PKCi                    ------------------------------------------------------------
PKCt_Mmus_PKCd                    --PPCVP---TP-G----------------------------------------------
PKCi_Mmus_PKCi                    ------------------------------------------------------------
PKCg_Mmus_PKCa                    QKTKTV----K--A----------------------------------------------
PKCh_Mmus_PKCh                    KLISR--------S----------------------------------------------
PKCe_Mmus_PKCh                    QRRKKL----A--A----------------------------------------------
PKCd_Mmus_PKCd                    ----------YQ-G----------------------------------------------
PKCb_Mmus_PKCa                    QKTKTI----K--C----------------------------------------------
PKCa_Mmus_PKCa                    QKTKTI----R--S----------------------------------------------
pkc-3_Cele_PKCi                   ------------------------------------------------------------
pkc-2_Cele_PKCa                   QKTKTL----R--A----------------------------------------------
kin-13_Cele_PKCh                  KKKPSI----M--T----------------------------------------------
PKC1_Scer_PKC-Unclassified        TPSPQK----V--GRDSPTKQHDPIIDKKISLQTHGREKLNKFIDENEAYLNFTEGAQQT
tpa-1_Cele_PKCd                   KNNGSLPNKLKN-L----------------------------------------------
PKCa_Spur_PKCa                    KKTKTI----K--G----------------------------------------------
PKCd_Spur_PKCd                    --HGYVP---DD-D----------------------------------------------
PKCe_Spur_PKCh                    KKSSFE----I--R----------------------------------------------
PKCi_Spur_PKCi                    ------------------------------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  PPDRSY----Y--SQ---------------------------------------------
AqueK016_Aque_PKCa                QKTERR----E--K----------------------------------------------
AqueK017_Aque_PKCd                PPLAAIPDDH-EIY----------------------------------------------
AqueK018_Aque_PKCh                SKRKSV----T--S----------------------------------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    ------------------------------------------------------------
PKCt_Hsap_PKCd                    --------KREP------------------------------------------------
PKCi_Hsap_PKCi                    ------------------------------------------------------------
PKCg_Hsap_PKCa                    --------TLNPVWNETF-----VF-----NLKPGDVERRLSVEVWDWDR----------
PKCh_Hsap_PKCh                    -------T----------------------------------------------------
PKCe_Hsap_PKCh                    -------GAESPQPASG--------------SSPSEEDRSKSAPTSPCDQ--------EI
PKCd_Hsap_PKCd                    --------FEKK------------------------------------------------
PKCb_Hsap_PKCa                    --------SLNPEWNETF-----RF-----QLKESDKDRRLSVEIWDWDL----------
PKCa_Hsap_PKCa                    --------TLNPQWNESF-----TF-----KLKPSDKDRRLSVEIWDWDR----------
Pkc53E_Dmel_PKCa                  --------CLNPVWNETL-----TY-----DLKPEDKDRRILIEVWDWDR----------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    --------NLNPVFNETF-----TF-----ELQPQDRDKRLLIEVWDWDR----------
Pkc98E_Dmel_PKCh                  -------GGEDN--YGA--------------S--------L-------GA--------DG
aPKC_Dmel_PKCi                    ------------------------------------------------------------
PKCz_Mmus_PKCi                    ------------------------------------------------------------
PKCt_Mmus_PKCd                    --------KREP------------------------------------------------
PKCi_Mmus_PKCi                    ------------------------------------------------------------
PKCg_Mmus_PKCa                    --------TLNPVWNETF-----VF-----NLKPGDVERRLSVEVWDWDR----------
PKCh_Mmus_PKCh                    -------T----------------------------------------------------
PKCe_Mmus_PKCh                    -------GAESPQPASG--------------NSPSEDDRSKSAPTSPCDQ--------EL
PKCd_Mmus_PKCd                    --------FEKK------------------------------------------------
PKCb_Mmus_PKCa                    --------SLNPEWNETF-----RF-----QLKESDKDRRLSVEIWDWDL----------
PKCa_Mmus_PKCa                    --------TLNPQWNESF-----TF-----KLKPSDKDRRLSVEIWDWDR----------
pkc-3_Cele_PKCi                   ----------------H-------------------------------------------
pkc-2_Cele_PKCa                   --------TLNPQWNETF-----TY-----KLLPGDKDRRLSIEVWDWDR----------
kin-13_Cele_PKCh                  -------DTSTD--ISG--------------S--------SN-------S--------EN
PKC1_Scer_PKC-Unclassified        AEFSSPEKTLDPTSNRRSLGLTDLSIEHSQTWESKDDLMRDELELWKAQREEMELEIKQD
tpa-1_Cele_PKCd                   --------FKS-------------------------------------------------
PKCa_Spur_PKCa                    --------NLNPTWGESF-----EF-----TMEESDRNRRLLVGVWDWDR----------
PKCd_Spur_PKCd                    --------EDLD------------------------------------------------
PKCe_Spur_PKCh                    -------KHHPP--LNN--------------S------RSLSLSSAPLLQ--------EL
PKCi_Spur_PKCi                    ------------------------------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  ---SPPPPAQSPPYGSPP-----TQ-----QMPPRPPGARVPVPYQQEHQ----------
AqueK016_Aque_PKCa                --------TLDPKFDESF-----FF-----DVSEQDLNNFVYVAVWDWDR----------
AqueK017_Aque_PKCd                --------MDVT------------------------------------------------
AqueK018_Aque_PKCh                -------V-KS-------------------------------------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    ------------------------------------------------------------
PKCt_Hsap_PKCd                    ------------------------------------------------------------
PKCi_Hsap_PKCi                    ------------------------------------------------------------
PKCg_Hsap_PKCa                    -----------------------TSR---ND----------FMG-AMSFGVSELLKAPV-
PKCh_Hsap_PKCh                    ------------------------------------------------L-----------
PKCe_Hsap_PKCh                    K----------------------ELE---NN----------IRK-ALSF-----------
PKCd_Hsap_PKCd                    ------------------------------------------------------------
PKCb_Hsap_PKCa                    -----------------------TSR---ND----------FMG-SLSFGISELQKASV-
PKCa_Hsap_PKCa                    -----------------------TTR---ND----------FMG-SLSFGVSELMKMPA-
Pkc53E_Dmel_PKCa                  -----------------------TSR---ND----------FMG-ALSFGISEIIKNPT-
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    -----------------------TSR---ND----------FMG-SFSFSLEELQKEPV-
Pkc98E_Dmel_PKCh                  D----------------------GAPGQ--SF----------RSCALSV-----------
aPKC_Dmel_PKCi                    ------------------------------------------------------------
PKCz_Mmus_PKCi                    ------------------------------------------------------------
PKCt_Mmus_PKCd                    ------------------------------------------------------------
PKCi_Mmus_PKCi                    ------------------------------------------------------------
PKCg_Mmus_PKCa                    -----------------------TSR---ND----------FMG-AMSFGVSELLKAPV-
PKCh_Mmus_PKCh                    ------------------------------------------------L-----------
PKCe_Mmus_PKCh                    K----------------------ELE---NN----------IRK-ALSF-----------
PKCd_Mmus_PKCd                    ------------------------------------------------------------
PKCb_Mmus_PKCa                    -----------------------TSR---ND----------FMG-SLSFGISELQKAGV-
PKCa_Mmus_PKCa                    -----------------------TTR---ND----------FMG-SLSFGVSELMKMPA-
pkc-3_Cele_PKCi                   ------------------------------------------------------------
pkc-2_Cele_PKCa                   -----------------------TSR---ND----------FMG-SLSFGISELMKEAA-
kin-13_Cele_PKCh                  S----------------------G-----------------Y------L-----------
PKC1_Scer_PKC-Unclassified        SGEIQEDLEVDHIDLETKQKLDWENK---ND----------FRE-A-DLTIDSTHTNPF-
tpa-1_Cele_PKCd                   ------------------------------------------------------------
PKCa_Spur_PKCa                    -----------------------ATR---ND----------FMG-ALSFGISXLMKSGV-
PKCd_Spur_PKCd                    ------------------------------------------------------------
PKCe_Spur_PKCh                    E----------------------GTSNRHSAFACHQPYSMHHYQSTSKI-----------
PKCi_Spur_PKCi                    ------------------------------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  -----------------------APP---RP----------PPG-AYDPSASGY-GSPY-
AqueK016_Aque_PKCa                -----------------------IGS---ND----------FIG-GMGLKVNDIITETCE
AqueK017_Aque_PKCd                ------------------------------------------------------------
AqueK018_Aque_PKCh                ------------------------------------------------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    ------------------------------------------------------------
PKCt_Hsap_PKCd                    -------------------------------QGI-SWESPL-------------------
PKCi_Hsap_PKCi                    ------------------------------------------------------------
PKCg_Hsap_PKCa                    ----DGWYKLLNQEEGEYYNVPVADAD---NCS-L--LQKFEACNYPLELYERVR-----
PKCh_Hsap_PKCh                    -------------------------------RR---------------------------
PKCe_Hsap_PKCh                    -------------------------------DN-R--GEEH-------------------
PKCd_Hsap_PKCd                    -------------------------------TGV--------------------------
PKCb_Hsap_PKCa                    ----DGWFKLLSQEEGEYFNVPVPPEGSEANEE-L--RQKFE----------RAK-----
PKCa_Hsap_PKCa                    ----SGWYKLLNQEEGEYYNVPIPEGDEEGNME-L--RQKFE----------KAK-----
Pkc53E_Dmel_PKCa                  ----NGWFKLLTQDEGEYYNVPCADD-EQDLLK-L--KQKP-------------------
PKCdelta_Dmel_PKCd                ------------------------------------------------------------
inaC_Dmel_PKCa                    ----DGWYKFLSQVEGEHYNIPCVDAF-NDIAR-L--RDEVR----------H-------
Pkc98E_Dmel_PKCh                  -------------------------------DS-L--ATSTT----------TMT-----
aPKC_Dmel_PKCi                    ------------------------------------------------------------
PKCz_Mmus_PKCi                    ------------------------------------------------------------
PKCt_Mmus_PKCd                    -------------------------------QGI-SWDSPL-------------------
PKCi_Mmus_PKCi                    ------------------------------------------------------------
PKCg_Mmus_PKCa                    ----DGWYKLLNQEEGEYYNVPVADAD---NCS-L--LQKFEACNYPLELYERVR-----
PKCh_Mmus_PKCh                    -------------------------------RR---------------------------
PKCe_Mmus_PKCh                    -------------------------------DN-R--GEEH-------------------
PKCd_Mmus_PKCd                    -------------------------------PEV--------------------------
PKCb_Mmus_PKCa                    ----DGWFKLLSQEEGEYFNVPVPPEGSEGNEE-L--RQKFE----------RAK-----
PKCa_Mmus_PKCa                    ----SGWYKLLNQEEGEYYNVPIPEGDEEGNME-L--RQKFE----------KAK-----
pkc-3_Cele_PKCi                   ------------------------------------------------------------
pkc-2_Cele_PKCa                   ----SGWYKLLSAEEGEFYNINITPEYDEDMEK-V--RKKMN----------ENF-----
kin-13_Cele_PKCh                  -------------------------------QQ-I--SE---------------------
PKC1_Scer_PKC-Unclassified        ----RD-------MNSETFQIEQDHAS-K---E-V--LQET----------------VS-
tpa-1_Cele_PKCd                   -------------------------------HQY-----SV-------------------
PKCa_Spur_PKCa                    ----DGWYKLLGQEEGEYYNVPAIAE-TESIEE-L--TSTI-------------------
PKCd_Spur_PKCd                    -------------------------------EA---VYEPL-------------------
PKCe_Spur_PKCh                    -------------------------------EE-M--SECAD----------KLT-----
PKCi_Spur_PKCi                    ------------------------------------------------------------
CC1G_07190_Ccin_PKC-Unclassified  ----TS-------PRSQPQGLPEKPSL-PSV-P-Q--QQQYQ----------QQRPPVGL
AqueK016_Aque_PKCa                GQRIESWYKLLGDNISRRKSIRIISD-EE-AEK-L--IDEYR----------KTT-----
AqueK017_Aque_PKCd                -------------------------------QDMIKPTVPS-------------R-----
AqueK018_Aque_PKCh                --------------------------------------EEN-------------------
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ------------------------------------------------------------


PKCz_Hsap_PKCi                    --------------------SI-KDDSE-DLKPVI--DGMDGIKISQGLGLQDFDLIRVI
PKCt_Hsap_PKCd                    ---------------------DEV--DK-MCHLPEPELNKERPSLQIKLKIEDFILHKML
PKCi_Hsap_PKCi                    --------------------SL-DQVGE-E-KEAM--NTRESGKASSSLGLQDFDLLRVI
PKCg_Hsap_PKCa                    --------M--GP--------SSSPIPS-PSPSPTDPKRCFFGASPGRLHISDFSFLMVL
PKCh_Hsap_PKCh                    ---------------------------Q-GKESSKEGN-GIGVNSSNRLGIDNFEFIRVL
PKCe_Hsap_PKCh                    ---------------------RAASSPD-GQLMSPGENGEVRQGQAKRLGLDEFNFIKVL
PKCd_Hsap_PKCd                    ---------------------AGE--DM----QDNSGTYGKIWEGSSKCNINNFIFHKVL
PKCb_Hsap_PKCa                    --------I--SQ---------GTKVPE-EKTTNTVSK-FDNNGNRDRMKLTDFNFLMVL
PKCa_Hsap_PKCa                    --------L--GP--------AGNKVIS-P----SEDR-KQPSNNLDRVKLTDFNFLMVL
Pkc53E_Dmel_PKCa                  ---------------------S-QKKPM-VMR---SDTNTHTSSKKDMIRATDFNFIKVL
PKCdelta_Dmel_PKCd                -------------------------------RFTA---PATVIPRFKNYSVDDFHFLAVL
inaC_Dmel_PKCa                    -----------------------DRRPN-EKRRMDNKDMPHNMSKRDMIRAADFNFVKVI
Pkc98E_Dmel_PKCh                  --------S--GY--------NSSSCMSLAVTGSGGVG-ATGETRPGKCSLLDFNFIKVL
aPKC_Dmel_PKCi                    --------------------ET-HDHAH-IVAPPP-PEDPLEPGTQRQYSLNDFELIRVI
PKCz_Mmus_PKCi                    --------------------NI-KDDSE-DLKPVI--DGVDGIKISQGLGLQDFDLIRVI
PKCt_Mmus_PKCd                    ---------------------DGS--NK-SAGPPEPEVSMRRTSLQLKLKIDDFILHKML
PKCi_Mmus_PKCi                    --------------------SL-DQVGE-E-KEAM--NTRESGKASSSLGLQDFDLLRVI
PKCg_Mmus_PKCa                    --------M--GP--------SSSPIPS-PSPSPTDSKRCFFGASPGRLHISDFSFLMVL
PKCh_Mmus_PKCh                    ---------------------------Q-GKEGSKEGN-GIGVNSSSRFGIDNFEFIRVL
PKCe_Mmus_PKCh                    ---------------------RASSATD-GQLASPGENGEVRPGQAKRLGLDEFNFIKVL
PKCd_Mmus_PKCd                    ---------------------SGS--DI----LDNNGTYGKIWEGSTRCTLENFTFQKVL
PKCb_Mmus_PKCa                    --------I--GQ---------GTKAPE-EKTANTISK-FDNNGNRDRMKLTDFNFLMVL
PKCa_Mmus_PKCa                    --------L--GP--------AGNKVIS-P----SEDR-KQPSNNLDRVKLTDFNFLMVL
pkc-3_Cele_PKCi                   --------------------EI-ESPGS-TSHDAS-RAMNGNGSSKWAVSLNDFRLLTVI
pkc-2_Cele_PKCa                   --------ITRDN--------SSSK-PK-DPAAPRASTLPLGSSNHNVIKASDFNFLTVL
kin-13_Cele_PKCh                  -----------D---------D-----S----GTTSSR-SASKVPGGTLSIHDFTFMKVL
PKC1_Scer_PKC-Unclassified        --------L--APTSTHPSRTTDQQSPQ-KSQTSTSAKHKKRAAKRRKVSLDNFVLLKVL
tpa-1_Cele_PKCd                   ---------------------EEQ--KE-TDEYMD-NIWGGGDGPVKKFALPHFNLLKVL
PKCa_Spur_PKCa                    -----------------------KKLPM-PTREASKSQNSNSNSSMGLVRASDFNFLSVL
PKCd_Spur_PKCd                    --------------------------------WTTDGGPPDRPVAVQKYSIDDFMLQKVL
PKCe_Spur_PKCh                    --------L--GD--------SKGHGGS-GMRTQSLQE-ELERKPSKRYNLDNFTFLKVL
PKCi_Spur_PKCi                    --------------------KN-RDSTA-SSTPST-APNGNDKIGNSPISLDDFELLRVI
CC1G_07190_Ccin_PKC-Unclassified  PPHVQPQRI--PPPQAAPQQ--GMVPPQ-HQQQMIQAQPQRQPSKKRKVGLDDFNFLAVL
AqueK016_Aque_PKCa                --------RANKV--------ATLKADIEALDLRRGSQLAPGSKDLPRMTLDDFKLLVVL
AqueK017_Aque_PKCd                ---------------------KGN--GA-AGRAPPP--PVPHKPAKPSYKLSDFQLIKVL
AqueK018_Aque_PKCh                -----------G----------PLKPPD-IPAPVRQIKAPEPAALQKVVTLDDFKFLKVL
AqueK019_Aque_PKCi                ------------------------------------------------------------
AqueK020_Aque_PKCi                ---------------------------K-PSDPFN-DFLNINPVSESQISLDDFDILKVI


PKCz_Hsap_PKCi                    GRGSYAKVLLVRL-KKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQA--SSNP----
PKCt_Hsap_PKCd                    GKGSFGKVFLAEF-KKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLA--WEHP----
PKCi_Hsap_PKCi                    GRGSYAKVLLVRL-KKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQA--SNHP----
PKCg_Hsap_PKCa                    GKGSFGKVMLAER-RGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALG--GRGPGGRP
PKCh_Hsap_PKCh                    GKGSFGKVMLARV-KETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLA--RNHP----
PKCe_Hsap_PKCh                    GKGSFGKVMLAEL-KGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALA--RKHP----
PKCd_Hsap_PKCd                    GKGSFGKVLLGEL-KGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLA--AENP----
PKCb_Hsap_PKCa                    GKGSFGKVMLSER-KGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALP--GKPP----
PKCa_Hsap_PKCa                    GKGSFGKVMLADR-KGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALL--DKPP----
Pkc53E_Dmel_PKCa                  GKGSFGKVLLAER-KGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALG--EKPP----
PKCdelta_Dmel_PKCd                GKGSFGKVLLAEL-RDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALG--TKHP----
inaC_Dmel_PKCa                    GKGSFGKVLLAER-RGTDELYAVKVLRKDVIIQTDDMELPMNEKKILALS--GRPP----
Pkc98E_Dmel_PKCh                  GKGSFGKVMLAEK-KGTDEIYAIKVLKKDAIIQDDDVDCTMTEKRILALA--ANHP----
aPKC_Dmel_PKCi                    GRGSYAKVLMVEL-RRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETA--SNHP----
PKCz_Mmus_PKCi                    GRGSYAKVLLVRL-KKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQA--SSNP----
PKCt_Mmus_PKCd                    GKGSFGKVFLAEF-KRTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLA--WEHP----
PKCi_Mmus_PKCi                    GRGSYAKVLLVRL-KKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQA--SNHP----
PKCg_Mmus_PKCa                    GKGSFGKVMLAER-RGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALG--GRGPGGRP
PKCh_Mmus_PKCh                    GKGSFGKVMLARI-KETGELYAVKVLKKDVILQDDDVECTMTEKRILSLA--RNHP----
PKCe_Mmus_PKCh                    GKGSFGKVMLAEL-KGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALA--RKHP----
PKCd_Mmus_PKCd                    GKGSFGKVLLAEL-KGKDKYFAIKCLKKDVVL