Protein (view, download) , Domain (view, download)
RSK4_Hsap_RSKp90                  MLPFAP---QD------------EP-------------------------W--D------
RSK3_Hsap_RSKp90                  MPIAQ----LL------------EL-------------------------W--K------
RSK2_Hsap_RSKp90                  MPLAQ----LA------------DP-------------------------W--Q------
RSK1_Hsap_RSKp90                  MEQDP----KP------------PR-------------------------L--R------
p70S6Kb_Hsap_RSKp70               MAAVF----D--------------------------------------------------
p70S6K_Hsap_RSKp70                MRRRR----RR------------DG-------------------------F--Y------
MSK2_Hsap_MSK                     MGDED----DD------------ES-----------------------------------
MSK1_Hsap_MSK                     MEEEG----GS------------SG-------------------------G---------
p70S6Kb_Mmus_RSKp70               MAAVF----D--------------------------------------------------
p70S6K_Mmus_RSKp70                MRRRR----RR------------DG-------------------------F--Y------
MSK2_Mmus_MSK                     MGDED----ED------------EG-----------------------------------
MSK1_Mmus_MSK                     MEGEG----GG------------SG-------------------------G---------
R04A9.5_Cele_RSKp70               MKQVS----MQ------------KF-----------------------------------
C54G4.1_Cele_MSK                  MEDIL-------------------------------------------------------
KIN82_Scer_RSK-Unclassified       MTQQE----YR------------SP-------------------------S--Q------
S6kII_Dmel_RSKp70                 MADVS----DP------------SE-----------------------------------
JIL1_Dmel_MSK                     MSRLQ----KQ------------NY-------------------------E--I------
S6k_Dmel_RSKp90                   MPLAD----SQ------------KD-------------------------L--R------
RSK1_Mmus_RSKp90                  MEQDP----KL------------PR-------------------------L--R------
RSK2_Mmus_RSKp90                  MPLAQ----LA------------DP-------------------------W--Q------
RSK3_Mmus_RSKp90                  MPIAQ----LL------------EL-------------------------W--K------
RSK4_Mmus_RSKp90                  MLPFAP---VE------------DP-------------------------W--D------
T01H8.1a_Cele_RSKp90              MGLQR----GM------------PL-------------------------A--Q------
YBR028C_Scer_RSKp70               MIFSL----DE------------EL-------------------------H--R------
YNR047W_Scer_RSK-Unclassified     MAGHH----HE------------HE-------------------------Q--E------
9468_Tthe_RSK-Unclassified        MSKVK----GG------------ID-------------------------Y--T------
4011_Tthe_RSK-Unclassified        MDLLL----AS------------QQ-------------------------N--D------
19190_Tthe_RSK-Unclassified       MSYNP----FS------------IT-------------------------NLYDIKNRSQ
29158_Tthe_RSK-Unclassified       MYQQG----QG------------GL-------------------------N---------
10726_Tthe_RSK-Unclassified       MADIE----VP------------DS-------------------------P--T------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                MAGHA----GV-------------------------------------------------
RSK1_Spur_RSKp90                  AKLGMPQFLSAEAQSLLRMLFKRNPQNRLGAGPNGINDIKSHAFFASILWX--K---LKK
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             MADVF----E--------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  MRGQA----AQ------------YE-------------------------N--L------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              MPLAQ----SH-------------P-------------------------W--Q------
AqueK024_Aque_RSKp70              MSDPD----LA------------DG-----------------------------------
RSK-p1_a-2_Smoe_RSK-p1            MAPTA----TT------------AA-------------------------V--S------
RSK-p1_a-1_Smoe_RSK-p1            MAPTA----TT------------AA-------------------------V--S------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            MESSC----GG------------IE-------------------------G--G------
RSK-p2_c-2_Smoe_RSK-p2            MGDDN----EE------------DR-----------------------------------
RSK-p2_a-1_Smoe_RSK-p2            MGTLD----TA------------KQ-------------------------P--N------
RSK-p2_a-2_Smoe_RSK-p2            MGTLD----TA------------KQ-------------------------P--N------
RSK-p2_b-2_Smoe_RSK-p2            MESSC----GG------------ID-------------------------G--G------
RSK-p2_c-1_Smoe_RSK-p2            MGDDN----EE------------DR-----------------------------------
RSK-p3_e-1_Smoe_RSK-p3            MPPHA----VA------------AE-------------------------E--R------
RSK-p3_a_Smoe_RSK-p3              MEALS----KN------------GG-------------------------R--M------
RSK-p3_b_Smoe_RSK-p3              MESTS----GS------------KQ-------------------------D--H------
RSK-p3_d-1_Smoe_RSK-p3            MLSRS----DS------------HG-------------------------S---------
RSK-p3_d-2_Smoe_RSK-p3            MLSRS----DS------------HG-------------------------S---------
RSK-p3_e-2_Smoe_RSK-p3            MPPHA----VA------------AE-------------------------E--R------
RSK-p4-1_Smoe_RSK-p4              MIVLP----RR------------RL-------------------------K---------
RSK-p4-2_Smoe_RSK-p4              MIVLP----RR------------RL-------------------------K---------
GK007_Glam_RSK-p3                 MSRPI----LE------------TG-------------------------T---------


RSK4_Hsap_RSKp90                  --------------------R-E-------------------------------------
RSK3_Hsap_RSKp90                  --------------------K-I-------------------------------------
RSK2_Hsap_RSKp90                  --------------------K-M-------------------------------------
RSK1_Hsap_RSKp90                  --------------------L-W-------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                --------------------P-A-------------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                --------------------L-A-------------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       --------------------R-LS-------K--G--RSMS-------------------
S6kII_Dmel_RSKp70                 ------------------------------------------------------------
JIL1_Dmel_MSK                     --------------------L-S-------------------------------------
S6k_Dmel_RSKp90                   --------------------Q-Q-------------------------------------
RSK1_Mmus_RSKp90                  --------------------L-R-------------------------------------
RSK2_Mmus_RSKp90                  --------------------K-M-------------------------------------
RSK3_Mmus_RSKp90                  --------------------K-I-------------------------------------
RSK4_Mmus_RSKp90                  --------------------Q-E-------------------------------------
T01H8.1a_Cele_RSKp90              --------------------L-G-------------------------------------
YBR028C_Scer_RSKp70               --------------------V-S-----------------LD------------------
YNR047W_Scer_RSK-Unclassified     --------------------R-DHE----Q-E--HEHDSLQ-------------------
9468_Tthe_RSK-Unclassified        ----PRL-------------TT---------------------GAN-----GETKK----
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       NNVQPLNSALSNYQNRSISPNTG-----------------GLLNS---SMNGQNNG----
29158_Tthe_RSK-Unclassified       ----------------------S-----------------NQNGYSNQQHIGQQIGQQIY
10726_Tthe_RSK-Unclassified       --------------------IFG-----------------SDAGS---------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  AELTPPFRPVIPTSDIVHYFD-T-------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  --------------------T-VPSPKRPT-E-GHDS--HS-------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              --------------------T-M-------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            --------------------M---------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            --------------------W---------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            --------------------W---------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            --------------------M---------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ----------------------NEG----AQQRGG-IDMLG-------------------
RSK-p3_b_Smoe_RSK-p3              --------------------Y-FS-------Q-----RSSS-------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 --------------------L---------------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  ------------------------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ------------------------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                ------------------------PD--------FRDREAEDMA----------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                ------------------------PD--------FRHREAEDMA----------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------LPK---------------------------
S6kII_Dmel_RSKp70                 ------------------------------------------------------------
JIL1_Dmel_MSK                     ------------------------GTSTSRLKNHQHPRESESLAYEEPDQMVRNHLNGQL
S6k_Dmel_RSKp90                   ------------------------------------------------------------
RSK1_Mmus_RSKp90                  ------------------------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ------------------------------------------------------------
RSK4_Mmus_RSKp90                  ------------------------------------------------------------
T01H8.1a_Cele_RSKp90              ------------------------------EPF---------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     ------------------------------RPT---------------------------
9468_Tthe_RSK-Unclassified        --Q--------------SNGL---------------------------------------
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       -SS---TPNYSNNYYIQTQGALQSST--------FQGSPNQNNT----------------
29158_Tthe_RSK-Unclassified       SNQSSGLNSYQVKQ----------------------------------------------
10726_Tthe_RSK-Unclassified       ------------------------------------------------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  ------------------------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ------------------------------LPR---------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------IPL---------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------IPL---------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ------------------------------IPR---------------------------
RSK-p3_b_Smoe_RSK-p3              ------------------------------MPK---------------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  ------------------------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ------------------------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                ------------------------------------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                ------------------------------------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------------------------------------
S6kII_Dmel_RSKp70                 ------------------------------------------------------------
JIL1_Dmel_MSK                     VANGNGKTRKNSNSETMTNGKKSKLNTEGSGSGSGKTLNYNNNNNNNNSISATNGQYTNS
S6k_Dmel_RSKp90                   ------------------------------------------------------------
RSK1_Mmus_RSKp90                  ------------------------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ------------------------------------------------------------
RSK4_Mmus_RSKp90                  ------------------------------------------------------------
T01H8.1a_Cele_RSKp90              ------------------------------------------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     ------------------------------------------------------------
9468_Tthe_RSK-Unclassified        ------------------------------------------------------------
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       ------------------------------------------------------------
29158_Tthe_RSK-Unclassified       ------------------------------------------------------------
10726_Tthe_RSK-Unclassified       ------------------------------------------------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  ------------------------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ------------------------------------------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_b_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  -------------------------------------------------------E----
RSK2_Hsap_RSKp90                  -------------------------------------------------------A----
RSK1_Hsap_RSKp90                  -------------------------------------------------------A----
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------LD----
p70S6K_Hsap_RSKp70                --------------------------------------------------GVFDID----
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------LD----
p70S6K_Mmus_RSKp70                --------------------------------------------------GVFDID----
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------------------------------------
S6kII_Dmel_RSKp70                 ---------------------------------------------------LFDLE----
JIL1_Dmel_MSK                     SSKTTSASARDYTYRETISPPTPPSPPTTNVADIVCISDAESEDGRDPEREYYDQD----
S6k_Dmel_RSKp90                   -------------------------------------------------------P----
RSK1_Mmus_RSKp90                  -------------------------------------------------------T----
RSK2_Mmus_RSKp90                  -------------------------------------------------------A----
RSK3_Mmus_RSKp90                  -------------------------------------------------------E----
RSK4_Mmus_RSKp90                  -------------------------------------------------------D----
T01H8.1a_Cele_RSKp90              -------------------------------------------------------G----
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     -------------------------------------------------------TGSER
9468_Tthe_RSK-Unclassified        ------------------------------------------------------------
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       --------------------------------------------------KQYQLD----
29158_Tthe_RSK-Unclassified       -------------------------------------------------------Q----
10726_Tthe_RSK-Unclassified       ------------------------------------------------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ----------------------------------------------------FDLE----
RSK1_Spur_RSKp90                  -------------------------------------------------------E----
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------FE----
CC1G_01261_Ccin_RSK-Unclassified  -------------------------------------------------------S----
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              -------------------------------------------------------K----
AqueK024_Aque_RSKp70              ------------------------------------------------------LE----
RSK-p1_a-2_Smoe_RSK-p1            -------------------------------------------------------P----
RSK-p1_a-1_Smoe_RSK-p1            -------------------------------------------------------P----
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              -------------------------------------------------------P----
RSK-p3_b_Smoe_RSK-p3              -------------------------------------------------------P----
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ---------------M----------EV-----F-----S--------------------
RSK3_Hsap_RSKp90                  ---------------V----------EP-----M-----E--------------------
RSK2_Hsap_RSKp90                  ---------------V----------ES--------------------------------
RSK1_Hsap_RSKp90                  ---------------L----------IP-----W-----L--------------------
p70S6Kb_Hsap_RSKp70               ---------------L----------E---------------------------------
p70S6K_Hsap_RSKp70                ---------------L----------DQ--------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ---------------L----------E---------------------------------
p70S6K_Mmus_RSKp70                ---------------L----------DQ--------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ----------IFARNLRSLQNNAPPGKN-----INVNCLNVNSCSL--------------
S6kII_Dmel_RSKp70                 ---------------L----------HD-----L-----E--------------------
JIL1_Dmel_MSK                     ---------------M--------------------------------------------
S6k_Dmel_RSKp90                   ---------------Q----------QQQQQQHV-----S--------------------
RSK1_Mmus_RSKp90                  ---------------L----------LP-----W-----L--------------------
RSK2_Mmus_RSKp90                  ---------------V----------ES--------------------------------
RSK3_Mmus_RSKp90                  ---------------V----------EP-----M-----E--------------------
RSK4_Mmus_RSKp90                  ---------------M----------EV-----F-----G--------------------
T01H8.1a_Cele_RSKp90              ---------------I----------TP-----S-----S--------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     TRSI--SFSKLLTR----------SWKR-----N-----ASS------------------
9468_Tthe_RSK-Unclassified        ---------------------------------------------NPTNKT---------
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       ---------------L-----------------Q-----------APRQA----------
29158_Tthe_RSK-Unclassified       ---------------I-------GQQYP-----Y-----------HPQNNMMSA-SRQNY
10726_Tthe_RSK-Unclassified       --------------------------SP-----T-----L-----SGKKKISQKSEQKDS
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ---------------L----------CE--------------------------------
RSK1_Spur_RSKp90                  ---------------F----------TS-----R-----T--------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ---------------L----------EG-----H-----E--------------------
CC1G_01261_Ccin_RSK-Unclassified  ---P--SLS---------------SWKS-----F-----LR-FPNQ--------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ---------------F----------KE--------------------------------
AqueK024_Aque_RSKp70              ---------------L----------DQ--------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ---------------S----------RPPRLDAV-----V--------------------
RSK-p1_a-1_Smoe_RSK-p1            ---------------S----------RPPRLDAV-----V--------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            --------------------------RN--------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            --------------------------EH-----Q-----G--------------------
RSK-p2_a-2_Smoe_RSK-p2            --------------------------EH-----Q-----G--------------------
RSK-p2_b-2_Smoe_RSK-p2            --------------------------RN--------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ---------QL-PRD---------ARGS-----L-----EVFQPQQ--------------
RSK-p3_b_Smoe_RSK-p3              ---VRDSLAQL-PRD---------SRGS-----L-----EVFNPQG--------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              --------------------------KS-----V-----S--------------------
RSK-p4-2_Smoe_RSK-p4              --------------------------KS-----V-----S--------------------
GK007_Glam_RSK-p3                 --------------------------P---------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  ------------------------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ------------------------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                ------------------------------------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                ------------------------------------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------------------------------------
S6kII_Dmel_RSKp70                 ------------------------------------------------------------
JIL1_Dmel_MSK                     ------------------------------------------------------------
S6k_Dmel_RSKp90                   ------------------------------------------------------------
RSK1_Mmus_RSKp90                  ------------------------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ------------------------------------------------------------
RSK4_Mmus_RSKp90                  ------------------------------------------------------------
T01H8.1a_Cele_RSKp90              ------------------------------------------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     ------------------------------------------------------------
9468_Tthe_RSK-Unclassified        --------------------------------SQKYSSNLNNNQQQTYQTGNSGTYPGVQ
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       ------------------------------------------------------------
29158_Tthe_RSK-Unclassified       AQNQVQMQQSLS----------------SYQVQQ--------------------------
10726_Tthe_RSK-Unclassified       NENVITLRRKISDCEEYQLQQCDNFSLDNKQLY---------------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  ------------------------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ------------------------------------------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_b_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  ------------------------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ------------------------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                ------------------------------------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                ------------------------------------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------------------------------------
S6kII_Dmel_RSKp70                 ------------------------------------------------------------
JIL1_Dmel_MSK                     ------------------------------------------------------------
S6k_Dmel_RSKp90                   ------------------------------------------------------------
RSK1_Mmus_RSKp90                  ------------------------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ------------------------------------------------------------
RSK4_Mmus_RSKp90                  ------------------------------------------------------------
T01H8.1a_Cele_RSKp90              ------------------------------------------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     ------------------------------------------------------------
9468_Tthe_RSK-Unclassified        RNSSTQQGNYQYQYRGNNSTNVPSSNV---------------------------------
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       --------------------NSPLSHTNSSQILKTQNTLTNQQQMQSSQIQNIQGLNGIP
29158_Tthe_RSK-Unclassified       ------------------SYAQPQVQK---------------------------------
10726_Tthe_RSK-Unclassified       ------------------------------------------------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  ------------------------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ------------------------------------------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_b_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  ------------------------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ------------------------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                ------------------------------------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                ------------------------------------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------------------------------------
S6kII_Dmel_RSKp70                 ------------------------------------------------------------
JIL1_Dmel_MSK                     ------------------------------------------------------------
S6k_Dmel_RSKp90                   ------------------------------------------------------------
RSK1_Mmus_RSKp90                  ------------------------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ------------------------------------------------------------
RSK4_Mmus_RSKp90                  ------------------------------------------------------------
T01H8.1a_Cele_RSKp90              ------------------------------------------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     ------------------------------------------------------------
9468_Tthe_RSK-Unclassified        ------------------------------------------------------------
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       QYQNLFQQTKNLNSSNGYQQNGFVPHQQQNVNQYNINNTEQYKEKSPMMTSNVNNGIQYS
29158_Tthe_RSK-Unclassified       ------------------------------------------------------------
10726_Tthe_RSK-Unclassified       --------------------NK--------------------------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  ------------------------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ------------------------------------------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_b_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  ------------------------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ------------------------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                ------------------------------------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                ------------------------------------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------------------------------------
S6kII_Dmel_RSKp70                 ------------------------------------------------------------
JIL1_Dmel_MSK                     ------------------------------------------------------------
S6k_Dmel_RSKp90                   ------------------------------------------------------------
RSK1_Mmus_RSKp90                  ------------------------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ------------------------------------------------------------
RSK4_Mmus_RSKp90                  ------------------------------------------------------------
T01H8.1a_Cele_RSKp90              ------------------------------------------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     ------------------------------------------------------------
9468_Tthe_RSK-Unclassified        ---------------EQQFSQTANSAFSQWNQQQKQQNIAQQTQQQQISLGQTSQQPAPN
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       MNQTVKKIP--TNNIQNTYESQ------------------------------TPKPPQQ-
29158_Tthe_RSK-Unclassified       -------IP--YSSIN-----M------------------------------ASISPRSQ
10726_Tthe_RSK-Unclassified       -------FPAGFS-----------------------------------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  ------------------------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ------------------------------------------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_b_Smoe_RSK-p3              ------------------------------------------------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ---------------G--------------------------------------------
RSK3_Hsap_RSKp90                  ---------------I--------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ---------------P--------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------------------
p70S6K_Hsap_RSKp70                ------------------------------------------------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------------------
p70S6K_Mmus_RSKp70                ------------------------------------------------------------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ---------------SASPSSQINMACNGNK-----------------------------
S6kII_Dmel_RSKp70                 ---------------L--------------------------------------------
JIL1_Dmel_MSK                     ------------------------------------------------------------
S6k_Dmel_RSKp90                   ---------------S--------------------------------------------
RSK1_Mmus_RSKp90                  ---------------L--------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ---------------T--------------------------------------------
RSK4_Mmus_RSKp90                  ---------------S--------------------------------------------
T01H8.1a_Cele_RSKp90              ---------------I--------------------------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     -----------------SN----NMS----V-----------------------------
9468_Tthe_RSK-Unclassified        KYQQQNTIENQNTIE---------------------YEDQNMQSLQTGSSQTTVLTNNSQ
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       ------------------------------------------------------------
29158_Tthe_RSK-Unclassified       TNAYNQQQQLQQNIS---------------------L-----------------------
10726_Tthe_RSK-Unclassified       ------------KIEE--------------------V-----------------------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                ------------------------------------------------------------
RSK1_Spur_RSKp90                  ---------------P--------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ---------------SSKKPSNV-------P-----------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------------------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ---------------Q------------------RSG-----------------------
RSK-p3_b_Smoe_RSK-p3              ---------------YSA-------SVVDKPPKGDIG-----------------------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  ------------------------------------------------------------
RSK3_Hsap_RSKp90                  ------------------------------------------------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  ------------------------------------------------------------
p70S6Kb_Hsap_RSKp70               ------------------------------------------------T-----------
p70S6K_Hsap_RSKp70                -----------------------------------------------PE-----------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ------------------------------------------------T-----------
p70S6K_Mmus_RSKp70                -----------------------------------------------PE-----------
MSK2_Mmus_MSK                     ------------------------------------------------------------
MSK1_Mmus_MSK                     ------------------------------------------------------------
R04A9.5_Cele_RSKp70               ------------------------------------------------------------
C54G4.1_Cele_MSK                  ------------------------------------------------------------
KIN82_Scer_RSK-Unclassified       ------------------------------------------------------------
S6kII_Dmel_RSKp70                 -----------------------------------------------QD-----------
JIL1_Dmel_MSK                     -----------------------------------------------EE-----------
S6k_Dmel_RSKp90                   ------------------------------------------------------------
RSK1_Mmus_RSKp90                  ------------------------------------------------------------
RSK2_Mmus_RSKp90                  ------------------------------------------------------------
RSK3_Mmus_RSKp90                  ------------------------------------------------------------
RSK4_Mmus_RSKp90                  ------------------------------------------------------------
T01H8.1a_Cele_RSKp90              ------------------------------------------------------------
YBR028C_Scer_RSKp70               ------------------------------------------------------------
YNR047W_Scer_RSK-Unclassified     ------------------------------------------------------------
9468_Tthe_RSK-Unclassified        LGKSDLFMQNYRVSNTYRPISSQNNINANQEKVQDNSHLKKQPNQLK-------------
4011_Tthe_RSK-Unclassified        ------------------------------------------------------------
19190_Tthe_RSK-Unclassified       -----------------------------------------------YQQQQQFQQATNK
29158_Tthe_RSK-Unclassified       ----------------------------------------------QQQQ----------
10726_Tthe_RSK-Unclassified       ----------------------------------------------DEE-----------
MSK_Spur_MSK                      ------------------------------------------------------------
p70RSK_Spur_RSKp70                -----------------------------------------------HD-----------
RSK1_Spur_RSKp90                  ------------------------------------------------------------
RSK2_Spur_RSKp90                  ------------------------------------------------------------
Y47D3A.16_Cele_RSKp70             ------------------------------------------------------------
CC1G_01261_Ccin_RSK-Unclassified  ------------------------------------------------------------
AqueK023_Aque_MSK                 ------------------------------------------------------------
AqueK025_Aque_RSKp90              ------------------------------------------------------------
AqueK024_Aque_RSKp70              ------------------------------------------------E-----------
RSK-p1_a-2_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1_a-1_Smoe_RSK-p1            ------------------------------------------------------------
RSK-p1-S1-1_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p1-S1-2_Smoe_RSK-p1           ------------------------------------------------------------
RSK-p2_b-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_a-1_Smoe_RSK-p2            ------------------------------------------------D-----------
RSK-p2_a-2_Smoe_RSK-p2            ------------------------------------------------D-----------
RSK-p2_b-2_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p2_c-1_Smoe_RSK-p2            ------------------------------------------------------------
RSK-p3_e-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_a_Smoe_RSK-p3              ------------------------------------------------E-----------
RSK-p3_b_Smoe_RSK-p3              ------------------------------------------------E-----------
RSK-p3_d-1_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_d-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p3_e-2_Smoe_RSK-p3            ------------------------------------------------------------
RSK-p4-1_Smoe_RSK-p4              ------------------------------------------------------------
RSK-p4-2_Smoe_RSK-p4              ------------------------------------------------------------
GK007_Glam_RSK-p3                 ------------------------------------------------------------


RSK4_Hsap_RSKp90                  -------------------------------------GGAS-------------------
RSK3_Hsap_RSKp90                  -------------------------------------E-TT-------------------
RSK2_Hsap_RSKp90                  ------------------------------------------------------------
RSK1_Hsap_RSKp90                  -------------------------------------R-KQ-------------------
p70S6Kb_Hsap_RSKp70               -------------------------------------EEGS-------------------
p70S6K_Hsap_RSKp70                -------------------------------------DAGS-------------------
MSK2_Hsap_MSK                     ------------------------------------------------------------
MSK1_Hsap_MSK                     ------------------------------------------------------------
p70S6Kb_Mmus_RSKp70               ---------------------------------