Protein (view, download) , Domain (view, download)
CDC15_Scer       MNSMAD-----------TDRV---------------------------------------
4322_Tthe        MLRR--------------------------------------------------------
DDB0229877_Ddis  MDTIK-------------------------------------------------------
DDB0229896_Ddis  MSKKEP------------------------------------------------------
DDB0229915_Ddis  MIEINN-----------NHN-NG-NGKQFPSSQ---------------------------
DDB0229971_Ddis  MNIKSE-----------LNYSNGSND----SD-IYN--------------EY--------
DDB0231212_Ddis  MSQPSL-----------L--------------N---------------------------
CC1G_00852_Ccin  MAAALVSSAKVPQVSRPL--------------PISSHSRRPNPPPEASSSRYPQQAPAPD
CC1G_05008_Ccin  MSTPSR-----------P--------------S---------------------------
GK076_Glam       MKRDKL------------------------------------------------------
GK077_Glam       MQTDNP------------------------------------------------------
                 *

CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  VFTSTSSTSETASRSFQRFFENSFRTATRSKKVPTPPVDEFATITAKAKKGKEKEREIHK
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  SDEAPSHKLNVFRKVTFRGKSGQEPPATSNDGSQRPKERVAGKTSFITPSMRQASMSSPA
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  LHLSSQALPSPKSQSAVPASSSSNADVLVSPTRPRTRRVSMQPAPPKEISAPSLPSPRTT
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  AQGPTRHRSSKSVPVAIPPSPSSPSLPSTSSESPVPTRVRHVPASPSHSPTPYSTSRVTP
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  IRSPSKTSGSATPRASSPACACSPSNRIRVATPSRGGASASTSHLPLSSSPSPTPRRPSV
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  DSPRRQPIESPRRTSADYARRPSLDVTSRQSPSPFHGEPPSPIRPRSRTPSQRAYSQNRH
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  FNISAGSLLLPSNPEHRDLIRTATSMLCKEILKPPPHMAKTDAGVRDWKEVEARTAALVR
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  LERIWSRPFSPTTSQSSPTTGAGEERERKLFCDALRDGFVLCQWVSIIQYLLVNVILTPC
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  --------------------------------------GGGSGDETYNKSDTVDFRSK--
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  AIRLLNKLRSSSVVRPDPREDGVTKSSNVTKFLAGCASYGLSGEDLFQQDDLIDGSSESL
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  ARVAQTIIALIKFVESPVPSRSKYMSGQGKSKPLPPSPYGTLSKSSNSTPNLLSTNPQSP
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------N------------------LTPIQR-----------------------
4322_Tthe        ----------------------------------VIQ-----------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ---------------------------------EEI------------------------
DDB0229915_Ddis  ------------I------------------MPDSKK-----------------------
DDB0229971_Ddis  ------------VIPQQSNLPPINNKTDRSHFRESMV-----------------------
DDB0231212_Ddis  ------------Q------------------L-NNI------------------------
CC1G_00852_Ccin  ASPTRKRWSPPSD------------------LPPLRSYSPGEKSVESVQTIRGVEDEDSM
CC1G_05008_Ccin  ------------S------------------MPAAKP-----------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  DEDGEEIEVKQMAVPIIKRPPPPPKSPLRKQASKSNDVGGLSAWSRATASPTRVSIASST
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  QATIGDISVRDSIPNIRQSRQSMASSVLSSTTLSTAPSSLLDNGQGNLGNRYGTIRTVTT
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  DLTSAAPSLTRAEGSSISETFARSSSIDIPKHRDRRSGEVQMTRVAEETDESISRVATRV
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  GGETKERGNASHDQRNERPAVHLRKGKWPDDFFDAFQMPNPARSSILDPDESLSRASPVS
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  ISKSSPRKIAIVGANRLHDDGSQPLPRRPTHRPRHSIDTPGLLPKEVALRRDASPDSSTS
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  RSPSGRVLLRRHSTKPATPTRTSLAPRSDDAPGSRGSDDSLVPFPRDRSTGVSTPTSPGG
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  DNILLERPRLRGRFQSEIEGASGRRGRPNSYDDVAARPARGRIESMVNLGVTSAATSASD
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       -------------------ASEKSVQYHLKQ-VIGRGSYGVVYKAINKHTDQVVAIKEVV
4322_Tthe        ------------------DKPQMVGNYKVGV-KLGQGASGTVYKGEHIETGQVVAIKLVS
DDB0229877_Ddis  -------------------ETDSFSKYQIGE-AVGKGAFGKVFKALNAETGDFCAIKQIE
DDB0229896_Ddis  ------------------KKNVTVGNYNLGV-VIGKGGFGTVYQGLDIEDGDFVAIKQIN
DDB0229915_Ddis  ------------------KSIVKIGEYTLGE-KIGRGAFGQVFKGLNGKTGEFVAIKQID
DDB0229971_Ddis  ------------------ASKKTIGAFVISDIAIGKGAFATVFKGLNTLSGDFVAIKRFE
DDB0231212_Ddis  ------------------VDKESCGDYLLID-IIGKGGFGVVYKGLHKTKGYFSAIKKIK
CC1G_00852_Ccin  LLARNSLDGSTGRALIVKEAGKPPTHFQLGN-CIGRGQFGSVYRALNLNTGQMVAVKRIR
CC1G_05008_Ccin  ------------------GGSKSLSGYQLGD-SLGKGAFGQVYRALNWETGETVAVKEIQ
GK076_Glam       ---------------------LLNGKYSINV-K---TNGERTYKALCNIDGIVPAIKIYR
GK077_Glam       --------------------LTIRGRYTLHC-LIGKGAFAKVWKAADEVTGGFVALKQLE
                                           : :            .::.     .   *:*

CDC15_Scer       YE------NDEELNDIMAEISL-LKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRL
4322_Tthe        TVN----IKKENIKSIKKEMHL-LKKLKHENIVTYIDFIQTENHYAIILEYIESGSLYGI
DDB0229877_Ddis  KTI----ISEKQLPSIIQEIKL-LQTLQHPNIVKFIESYETSRYLYFALEFIEGGSLAKI
DDB0229896_Ddis  LTK----IPKDQLQGIMNEIDL-LKNLNHANIVKYIKYVKTKDNLYIVLEYVENGSLSGI
DDB0229915_Ddis  SNK----IDESSLQSVKGEVEI-LHKLRHNNIVKVLGVVEVQAQLNFILEYVENGSLRDV
DDB0229971_Ddis  KSK----ISNEQHSSVSTEFDI-LQRLNHENIVRILGREENENYIYIFLEYMENGSLSTI
DDB0231212_Ddis  IMKKK-KLQSESQISLMAEINL-LKVLSHHNIVRYYEHIPSSSHSYIVMEFIENGSLEKI
CC1G_00852_Ccin  LEG----LKEEEVTQLMREVDL-VKSLSHPSIVKYEGMARDEDTLSIVLEYAENGSLGQT
CC1G_05008_Ccin  LSN----IPKGELPEIMSEIDL-LKNLNHENIVKYKGFVKTREFLYIILEFCENGSLHNI
GK076_Glam       LSD----VSKSSVDFDQKEIDTAARSLLQPNLVKYIEAFADKEYFYVVMEFVPN-SLDQI
GK077_Glam       PKGKKKAVDQGFIKEVMSEINL-LSKLNHSNIVKYRGCFLEQNYLYIILELVDFGSLQTL
                          .        *.      * : .:*             . :*     **

CDC15_Scer       ISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSA---DNTVKLADFGV
4322_Tthe        IKKFG-PFQESLVIIFIKQVLRGLEYLHRQGIVHRDIKGANILTTKNNKSGVIKLTDFGV
DDB0229877_Ddis  AKRYG-CFQEPLLSRYFSQVLKGLAYLHEKGVIHRDIKSDNILITK---EGVIKLADFGS
DDB0229896_Ddis  IKKFG-KFPETLVCVYIRQVLEGLVYLHEQGVVHRDIKGANILTTK---EGKIKLADFGV
DDB0229915_Ddis  IEKFG-PLSEELCIIYLYQMLQGLAYLHSNKVIHRDIKASNILITK---EGVIKLADFGV
DDB0229971_Ddis  LNNFG-TFPESLICNYVENVLKGLVYLHQEGVIHRDIKAANILINK---AGEAKLSDFGT
DDB0231212_Ddis  IKRHG-LLPESLVTVYIAQVLNGLEYLHRQGVIHRDIKAANLLIST---DGSIKLADFGV
CC1G_00852_Ccin  LKAFG-KLNERLVASYVVKILEGLHYLHTSDVVHCDLKAANILTTK---NGNVKLSDFGV
CC1G_05008_Ccin  IKKFG-KFPENLVAVYISQVLEGLVYLHDQGVIHRDIKGANILTNK---DGTVKLADFGV
GK076_Glam       IAH-QR-STEHLAALYVTQIVKGLIFIHYNGYTHKRITPEHILITN---DGFVKISDFVL
GK077_Glam       IKQYD-DLGENVVACYIYQILLGLKYLHEQGIIHKDIKAANILMTS---SGLCKLTDFGL
                          *     :. : : ** ::* .   *  :.  ::* .     .  *::**

CDC15_Scer       STI-VNSSA-----LTLAGTLNWMAPEILGN--RG-ASTLSDIWSLGATVV----EMLTK
4322_Tthe        ATH-LADDD--KSSTQCVGTPYWMAPEVIIDS-DGHISTSCDIWSLGCTII----ELLTG
DDB0229877_Ddis  CTY-SAID----RKLTVVGTPFWMAPEVIQMDMNA-RSTACDIWSLGCTLL----EMLTG
DDB0229896_Ddis  ATK-FDDTS----AAAVVGTPYWMAPEIIEL--NG-ATTKSDIWSVGCTVI----ELLTG
DDB0229915_Ddis  ASQ-IDSES--QLRFSVVGTPYWMAPESIEI--SG-CSSASDIWSLGSTMI----ELLTG
DDB0229971_Ddis  AGE-IIKES--DKRYSVVGTPYWMAPEVIEI--SG-HCQVSDIWSLGCTII----ELFTS
DDB0231212_Ddis  ATK-VSDLSSDNPDDTFAGTPYWMAPEVIQM--QG-ISTACDVWSLGCTII----ELLTG
CC1G_00852_Ccin  SLN-LRAME--REIKDVAGTPNWMAPEVIEL--KG-ASIKSDIWSLGCTHVWYVKEFHRR
CC1G_05008_Ccin  AAR-TGGVV----DGAVVGSPYWMAPEVIEQ--SG-ATTASDIWSVGCVVI----ELLEG
GK076_Glam       QNAYFADGD-----K----DVRDMAPEEILL--LG-RTTAVDIWNLGLLLF----NCLAR
GK077_Glam       SQR-LQDVD----PTVVEGSPYWLAPEVINE--EG-VSTKSDVWSLGATMI----ELLTK
                                        :*** :     .      *:*.:*   .    :

CDC15_Scer       NPPYHNLTDANIYYA-------------VENDTYYPPSSFSEPLKDFLSKCFVKNMYKRP
4322_Tthe        NPPYSYGNPHHALFR------------MVSDQHPPLPKDVTPQCLDFLMQCFNKEPSQRM
DDB0229877_Ddis  NPPYWDLGTMPAMFA------------MVNNPHPPIPNNISADLKHFLLACFVRDINKRP
DDB0229896_Ddis  SPPYYDLGQMPALFR------------IVQDDCPPLPEGISPPLKDWLMQCFQKDPNLRI
DDB0229915_Ddis  NPPYYTLQPMAAMFR------------IVSDQHPPFPTDISKEFLDYFQQSFKKDPTQRP
DDB0229971_Ddis  YPPYFDLNPLGAMYR------------ICQDDRPPLPDDISSELANFLERCFCKSTEERA
DDB0231212_Ddis  TPPYFGLAPAAALYK------------IVQEDHPPIPPGISAALKDFLLNCFKKDENIRS
CC1G_00852_Ccin  SLPWFNHD-ATVMFR------------IVEDDMPPLPEGCSELLEDFLKQCLQKDPNNRP
CC1G_05008_Ccin  RPPYHNLDPMPALFR------------IVQDDCPPIPEGASAIVKDFLYHCFQKDCNLRI
GK076_Glam       EHFFKNMADQEIIRLFQSTNAQNTINELVTFRLAECNLNVSQACKEFILACLSIDYTFRP
GK077_Glam       KPPFHNLTGFAAMYN------------IATLTEMPLPPNISPECADFLSCCFKIDPHERH
                    :                                  . :    .::  .:  .   *

CDC15_Scer       TADQLLKHVWINSTENVKVDK---------------------------------------
4322_Tthe        DAKSLLNHEWLKINIETEV-LQIINSPNPELPEEVL-NS-IRNHINESQHELDMNSNSKQ
DDB0229877_Ddis  TASQLLEHPWIKQHIHEPSQSQPASSPEPSRIKSSG-SG-SKLSINTYAEGYDVESDDDT
DDB0229896_Ddis  SAQKLLKHKWIQASIKKKPVENG-AGGVGNGTD----------SLGA-----PA------
DDB0229915_Ddis  TAQELLQHPIFFTLQKVPPTLSEL-----QSTLKTL-NG-GRSRLRTSVNSIDWGSSSST
DDB0229971_Ddis  TAKELLSHPWITKNRTNLINHQRNSSKQFTSPQIII-NNHQKSLLSNSSGGDDSVTDSDL
DDB0231212_Ddis  SAKQLLHHPWVKSVQIRNPETQAPKNARQ--------------EILSY----NA------
CC1G_00852_Ccin  TAELLCEHEWLKANWMELKDLRPQDSI-PFLRR--------------VS--TDM------
CC1G_05008_Ccin  SAKKLLKHPWMVATRKQMNAGKAQSGE-QAGDNASGSQG-TRRPLSNYN--YDE------
GK076_Glam       SAQSLLQASFLKQTNTEIVCGKTGAST-LN-QN----------QIDEI------------
GK077_Glam       SCAELLNHPWLIKNANSLMRQKQLVGP---------------------------------
                  .  *     .

CDC15_Scer       ----------------LNKFKEDFTDADYH-------W--DA-DFQEEKLNI-S--PSKF
4322_Tthe        SASKQDNNQN--H---LEK------------------------HLLQEQNYISN------
DDB0229877_Ddis  TNSNN--GSDHDRIQQLESQKKEMTETIKRLKLHFLRAMKEKKVMKDMISQLVT---ERD
DDB0229896_Ddis  ---------------NIDDIAKN---------------------ITDYNERINK--KPSH
DDB0229915_Ddis  SGSSTPLSS---------------------------------------------------
DDB0229971_Ddis  SISNQSSR----------------------------------------------------
DDB0231212_Ddis  ---------------QLQD------------------------IIQDNNSNITR---PRS
CC1G_00852_Ccin  -------------------QKSD---------------------VSRYFNQFE-------
CC1G_05008_Ccin  -------------------AVLK---------------------VQEWNEALKSPTRPSK
GK076_Glam       --------------QALNDVSAGLTTLTSQI-PDKGHA--AT-NIQSTLNHVVT--KSAK
GK077_Glam       -----------------RESAK-LTLTNNMLPPPKGFSLPGSPKESSRRSSRES--STGK


CDC15_Scer       SLR---AAPAPWAENNQELDLMPP-TESQLLSQ-L-------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  E--YMIKLGLT-----P--PPLPPILANATLNSKSSLDSSNELLNKESSQGNLLGSGGSG
DDB0229896_Ddis  QRKPSIHPKSP-----KGKVFLPP-PEEEEDEWGDDF-----------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  -----------------SS-------------------------------SFLLDDGGGG
DDB0231212_Ddis  S--AVVQPPSP-----S--QLVPP-LTNMNISSSNDNNNNN---NN--------------
CC1G_00852_Ccin  ------TPDSP-----VSE-------------------------------GFVRGDAGRV
CC1G_05008_Ccin  QPSRYTRPHSP-----LQR-------------------------------HSELHSSSSS
GK076_Glam       QLT-----------------TIPP-PTPPYS-N-F-------------------------
GK077_Glam       DVQ-----------------ALPP-TKEPNSST-LDMHTLQ---NP--------------


CDC15_Scer       -----------------KSSSKPLTD--L---HVLFSV-----------CSLENIADTII
4322_Tthe        -----KENDKD-------------------------------------------------
DDB0229877_Ddis  SPYTNHTRSSSAPLTAPGKII-----------------STHQIHSPSLSNSSAS---AST
DDB0229896_Ddis  -------------SNTPKSIKLPDKKSPLKLT----NN---KPSTP--------------
DDB0229915_Ddis  -----SSSSSN-------------------------------------------------
DDB0229971_Ddis  GGSKNHTV----------------------------------------------------
DDB0231212_Ddis  ---------SSATNNSPNISSTTTKNN-SSTT----NNNNNKLTSPSLSSSLLPIPATST
CC1G_00852_Ccin  APISRRT-----------------------------------------------------
CC1G_05008_Ccin  TSLSSHTP------GALGW-----------------K--GGMSGNPKLGTLVEKIQ----
GK076_Glam       -----------------SRAQETEGD--SKTISSGFNK----QDQEILRRAILNIPSASE
GK077_Glam       ---------SYPKSTSPKVSEKPLSK--S---SVRHNA---GSSAPQFSSLTHDTLATRL


CDC15_Scer       ECL--SRTTV--------------------------------------------------
4322_Tthe        -----------------IKDTQQIH--------------ANYNSTLQNSINQSISS----
DDB0229877_Ddis  SGVSNNKERGSSILTNDFFHPPS-DDDQHSPTNDLFLH-EHFEKNLKVTASSSPSSLSK-
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  -----------------IKSIVS-D--------------EDFNK-LQTTIKQQAQT----
DDB0229971_Ddis  ---------------ILTKQQPT-PDQI------------EFNK-MQM------------
DDB0231212_Ddis  STV--NQNKASPTLNSSWSAVPS-NK--ISQTVNSIDK----------------SSLNKI
CC1G_00852_Ccin  --------------SNLSVRPPP-ENDI--------------------------------
CC1G_05008_Ccin  --------------PHAFVLQPP-EEQT-DNWDDDFEGGISFTK-LQALE-KSTHEED--
GK076_Glam       ECR--NSYAISA------------------------------------------------
GK077_Glam       ETV--RTRRLERDF----------------------ERSESLFG----------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  NSRLTTKF--ELESDNNTNNNNNNNNNNNNINITTTTTTTTTTPASNQNLGAYYQSSGNL
DDB0229896_Ddis  -------L--KQQPTNNTPVQQQQQ-----------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  NNGSGQHV--QIASPRKLSAGQKQSIQPNIIAAAATTTTTTTT-----------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  KSEPNEDNAQTIR-PTKSPGAK--------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ------------------------------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------LK----------------------
DDB0229877_Ddis  HLYTNQNNLTNNNINNTNNNNNNNNNNNNNNNLG--------------------------
DDB0229896_Ddis  --------------------------------------------QQQPPPLKLAVPKQPV
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  TTTTN--AATNTTTTTTPSST----------NTGSNVTSPVVSAISTPPPIP-TTPLSPM
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ---------------TVP--------------------------LAQPPA----ASIAPI
GK076_Glam       ------------------------------------------------------------
GK077_Glam       ---------------ADP--------------------------LINIQT----DSILSI


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        --N-IQLAQ---------------------------------------------------
DDB0229877_Ddis  ---------S--------------------------------------------------
DDB0229896_Ddis  IENDDDWGDDFNTVSDLSKAVGSLNFNN-----------NKKNE----------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  MKSQEQLNQE--------------------------------------------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  VEDYSDLAL-DEDEGWLEEKVADF------------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       NSDSDDLTL-FPDIQDLSDDNKY---NSLIGTMSNDILDVSCKEPPGQDSVIIDGVMRHT


CDC15_Scer       --------------------------------------------DKRLITAFGS------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------NTNVDMYLR--------------------------------------T
DDB0229896_Ddis  ------------TPKPNIKKP--------------------------------------T
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------KEKINLHLR--------------------------------------K
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  --------------KNQAEFG--------------------------------------K
GK076_Glam       ---------------------------------GDAATLAAMRSPEKAINTFTCIPATAN
GK077_Glam       FMSNILMTPKINKKAIKQHLRILEKNVFASYSIIDAHKLLKAISTSQKRKKLSCIFRGHM


CDC15_Scer       -IFVYDTQHNHSRLRLKFIAMGGIPLIIKFEHLAKEFVIDYPQTLIECGIM---------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  SSEK----------------------------------------------THLSITQPVS
DDB0229896_Ddis  FSED----------------------------------------------ED--------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  FSEK----------------------------------------------ES--------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  YTED----------------------------------------------DD--------
GK076_Glam       FPMPDDAPNNKQKLRAKSIEAGAK-QGKKLKHRV--------ENKLECVDNQ--------
GK077_Glam       FPQK----------------------------------------------QQ--------


CDC15_Scer       ---------------------YPPNFASLKTPKYILELVYRFYDLTSTAFWCRWCFKHLD
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  LSGALSYGDHLNPSVTIGGHN-----SLKQKGSGKTSIPVL-------------------
DDB0229896_Ddis  ---EDDDDDGF----GSGGDD-----EDDDFGDIPTSIKL--------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ---DDEFDNIVLPNSTIC-LQ-----KLQPILSHKPPIQ-L-------------------
CC1G_00852_Ccin  ----SPREHTF----V--------------------------------------------
CC1G_05008_Ccin  ---DDDYDDVF----G--------------------------------------------
GK076_Glam       ---------------------LDDSSFDLQDVKIIGKLEVK-------------------
GK077_Glam       ---EAIAD-------GSGGHQNPTNGEEDPSPFLPYELDLESLQPTETA-----------


CDC15_Scer       ISLLLNNIHERRA--------QSIL---LKLSSYAPWSFEKILPSLIDSKLKKKILISPQ
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  --------QKEPSN--------KSL---NSL---------------------NN------
DDB0229896_Ddis  ----------NPKF--------GSNIKGNSS---------------------GS------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  --------QRQQSF--------NAN---NNI---------------------SN------
CC1G_00852_Ccin  ----------KT----------T--FSK--------------------------------
CC1G_05008_Ccin  ----------KP----------NSNIAT--------------------------------
GK076_Glam       ------------------------------------------------------------
GK077_Glam       -GVLISNIMEKRGFLSVIQHIDNIL---INI---------------------EN------


CDC15_Scer       ITYVVFKSI---------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ---------NN-------------------VNNNNNNNNN------NNNNNNNNNNNNN-
DDB0229896_Ddis  ---------AN-------------------TTNSSSTVVQQPKLTVSNNNNNNNKKLPL-
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ---------SN-------------------SNNNNNNNNN------NNNNNNNNNNNNN-
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       --------RYEDSTTGDNFSDVIENDPAVDKGHHLGGSVAD-------------------
GK077_Glam       ---------SSLASSMDHFNEVCVNLNNLYNTHPIETSVLKNKLKALRERQQNYQGLPLT


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ---------------------------------QEKRLIGL----------------RLN
DDB0229877_Ddis  NNNNNNNTN---------SNSNNNTNNINSTNN---------------------------
DDB0229896_Ddis  SPRQPSSGN---------VKEGINHGST-GSKSGGVIIDQWGEDGEEDNDWGDVATVNFD
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  SNNNNSSNN---------SNNNSNSNSINSSNSHKLKLLKFNKFTEKDNE-DDETDLVFD
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       --------HIQSKPRLIQTNS---------------------------------------
GK077_Glam       TPRDQESTHRTKALYSSNPDADS-------------------------------------


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        EP--N-----------------------------------TCRNQTA--NQT---IDEIG
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  PKVIRKGT--------------------------VNKPDLSTRLKNRIALSETALSNSFN
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  -------E--------------------------LQ--LL----RLRVG-----------
DDB0231212_Ddis  QKVSD-----------------------------------TSRFKVR--NQKKDWDDEFD
CC1G_00852_Ccin  -----PMM--------------------------CRVCLL----NVKKS--------AVL
CC1G_05008_Ccin  -----GMS--------------------------MQTLQL----NTRLS--------S-K
GK076_Glam       ---------AVSSSNLNPQKKNQTKTQRTASKPAR-------------------------
GK077_Glam       -------NQSSTASGYDSIQM------------SF-------------------------


CDC15_Scer       --------------NYMITTNDDKIHKSAIPSS---------------------------
4322_Tthe        SFAGSIVDN---------------------------------------------------
DDB0229877_Ddis  --------------------INTNNINNVLGTSPSRKISNSDQFTP--------------
DDB0229896_Ddis  N-NGN-------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  NF-GSSGDESESSTATTNAAINSNIAKKILPSNRIIRYSSSGQLKQQQQQLLLQQQQQQ-
CC1G_00852_Ccin  CAQCS-------------------------------------------------------
CC1G_05008_Ccin  SWLGD-------------------------------------------------------
GK076_Glam       --------------NHALSAGDDLIYDAAAADK--------------HSEKIHP-KTRKT
GK077_Glam       --------------STLKVHNTASLHSPAKPSS---------------------------


CDC15_Scer       -------SSLPLSSSPTRN---------------------------------------SP
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  -----------------------------------------Q------------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       QRAMSTVTTRAIAKQPTYQNAYSRNAGAAAGTARQDPCYTTLATGWAKREMNTKSKRNFP
GK077_Glam       -------RGRHMPSS------YAAGMQK---TSMV------------------RPQYHSL


CDC15_Scer       VNSVQSPSRS--------PVHSLM------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  NRKSSQPIAPSFSLLN--------------------------------------------
DDB0229896_Ddis  ------------------------D-----------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ---------ELETDL---------------------------------------------
DDB0231212_Ddis  QQHLQQPLSPSEMKLKVKETSEEWD-----------------------------------
CC1G_00852_Ccin  ------------------------L-----------------------------------
CC1G_05008_Ccin  ------------------------D-----------------------------------
GK076_Glam       EQSLLTTTKD--------PVFPIAQTALKRTTCPLSLDTLDDHWNSNSYSSDDNILKNSS
GK077_Glam       TNTLQSNLHSSSLEPLVLKKFGELGS-FPESNHSLLDEALPS------KS----------


CDC15_Scer       -------------------------ATRPSSPMRHKSISNFP-------HLTISSKSRLL
4322_Tthe        ------------NKPLDS-LRNYN---LKKKNNGTL------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ---------DEDEDIFADDFDEDDD--EDFDLDKNL------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------KKEQDL------------------------
DDB0231212_Ddis  ---------TEFEESFDT-ISWSE---ADNQRTINI------------------------
CC1G_00852_Ccin  ---------ISHAKCAAS-A------------PPTC------------------------
CC1G_05008_Ccin  ---------GDEEDPFAE-IDEGFD---EDDLESNL------------------------
GK076_Glam       LKHTNCPYRAPDGNNSCSEISCTDMVNPLSSKSHHKSIFGDERSKDHSDK--------LI
GK077_Glam       ---TNVPFLGAAQEFFGKEFDEKYYLNADLRDRNNKSKRGDP-------KAAMSLATRRA


CDC15_Scer       IEL--------PEGFFTWLTSF-FVDMAQI---KDL-SV----LKYFTKLCYLTV--HIN
4322_Tthe        ---NSKKEQKMYQDT------QEI---------------VNGLQKTREPK----KVEEYM
DDB0229877_Ddis  -----------------------Q---------------SLDRNPNSNNN----N-----
DDB0229896_Ddis  ---MKDNYARMSSEI------LKL---------------MNLLTPEQPEE----VISSAC
DDB0229915_Ddis  ----------ISNLS------EEI---------------LILKKELKEKP----KLEE--
DDB0229971_Ddis  ---KKDSDRKY-------------------------------------------------
DDB0231212_Ddis  ---QDKYREQVVKTI------VEF---------------ILQLKPNQPND----VLIDTC
CC1G_00852_Ccin  ---DLRAQLLLYAQY------AEK---------------GNPSSAYSNPK----DLLGD-
CC1G_05008_Ccin  ---QRDKHARLCNAV------NQL---------------IDELTPSAPDF----QLRDAC
GK076_Glam       ASLSIENNAQGPENL-----DM-FVDKSQKSGTKKVSLT----RSDFPKDSLHTA--PIS
GK077_Glam       IFW--------NAALTLYMYEY-CIELCK---------ILYVLCQYSPRL----IMNLTA


CDC15_Scer       STF---LNDLLDNDAFFAFI----------------------------------------
4322_Tthe        NYLSDII-----------------------------------------SRFPKAKSYFIK
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  TQLITMF-----------------------------------------KENSEQKTLLIR
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  QKLTDLF-----------------------------------------QTYPDERKLLIS
CC1G_00852_Ccin  ------------------------------------------------TRFP--------
CC1G_05008_Ccin  DQLLKII-----------------------------------------IEAPEMQGQLVS
GK076_Glam       PESPQEIKTYVDNDINEAYTFSTVSAEPVQPFVLHFGGSPAATSRLCTVTNLDKRSSR-Q
GK077_Glam       LGLPPLMKRLIDFKISNSITFVESISDFF----------RAIKSQTCEAVNSESRGFKFM


CDC15_Scer       -----------RNIDTIIPFIDDAKTAA-------FIW---KQITAICVEMSLDMDQMSA
4322_Tthe        QSG---------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  RHG---------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  NGEGGV------------------------------------------------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  SHG---------------------------------------------------------
GK076_Glam       EN--CQNDDPSINLDTI-ALPQDQDIMS-------LMH---KRQLM-LQQMDPHMDDTSS
GK077_Glam       RH--SQDAQTTLQNDTI-STARSGRVNGQFDSGTTTNQKSQIQHDT-IRSLDCHL--TTH


CDC15_Scer       SLF-STAMN---------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  -----------------------------------------YFRLP--------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       AFSSGTSMANLE-------------------------------------KKAAVIESGKD
GK077_Glam       LFLTYTTLKNQNTDDKYALKSFLGEFKATADRTLLAFRSFTYSSLPINVGADRVSEKDKE


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       TPKSGAASPSRLVYQQKNSS----------------------ADNIANNHLGLAK--DVL
GK077_Glam       RPKYSARKGTKDYYEIIHSTTVPARSYAHLLQLPNVPRFSCTSKTLENDHAGLSHYPSML


CDC15_Scer       ------------------------------------------------------------
4322_Tthe        ------------------------------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ------------------------------------------------------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ------------------------------------------------------------
GK076_Glam       ANQQKRQC---TDPSSLSASTDMLTQKSHNGFYEENSALN-RFEEKMTDTSSTYDEYDDY
GK077_Glam       TGR-ETPSIVPTNIPTVVPIVDKDTGHTNSSIYGEDSCVGFQIDPSAADSSQKLVSYP--


CDC15_Scer       -----------FIRKKNNTSISGLE-----------------------------------
4322_Tthe        --------------------LSLFLDLLDKFS----------------------------
DDB0229877_Ddis  ------------------------------------------------NNNN--------
DDB0229896_Ddis  --------------------VIPIMEMLEVSN----------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  --------------------IITILEILEDNCCCNSDTPSDVITTTYHHNNN--------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  --------------------MLAILEVLEGRC----------------------------
GK076_Glam       EGLENHEAAL-FIMTTDKTDVEELREILT----------------NYKINNKISVSSVEQ
GK077_Glam       ---CDKDALINVLQGETRTVVSDLLQVFID--------------GNFASAEFISIDYCLI


CDC15_Scer       -------------------------------------------IIL--------------
4322_Tthe        ------------------------TNFTI----------IQQVLSFLNQIVENEMYYLET
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ------------------------IQSHV----------LCSILKVVNQIIDNNMEIQEN
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  --------------------------REI----------LL-------------------
DDB0231212_Ddis  ---------------SD-TFSEDFSNVEL----------VINLLKLLNQSIIKEKDIQET
CC1G_00852_Ccin  -------------------------------------------------VAMSDVPFVS-
CC1G_05008_Ccin  -------------------------SRDV----------IMKLLQIINVLVTEDVGFLES
GK076_Glam       VRKLICSSKRCLAYVRD-NFSVNFWFVKFKQLVDTGKEEAILVLILISTIARLDFPFCRD
GK077_Glam       LHSQILQLCDCLLSTKDARFVIQVIGIIYKLVFKDKTSKARKVGIL--------------


CDC15_Scer       ----------NCL---------------------HFT--------L-RNVNDDVA-----
4322_Tthe        ACLFGVVPQILKFTSDFYPKEIRFEVSCFIAQLF-TSPSTLQIFVA-CGGSSALVDLLDV
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  LCLVGGIPAIMKFSGPEYPASVRLETASFISKMCSTSTLTLQMFIA-CKGLPILVDFLLS
DDB0229915_Ddis  --------------------------QQFYKEYF--------------------------
DDB0229971_Ddis  ------------------------SSMHYIYII----DSTMNTIT-NSGG----------
DDB0231212_Ddis  ICLMNGISIITKLATKQFDELIREEVSKFVLQLCSYSTYSLNMFITGSRGCKVLVDLLDS
CC1G_00852_Ccin  -----------------SPSSARTETP--------PP-----------------------
CC1G_05008_Ccin  FCLIGGIPVMMEFTSKKYPSECRLEASNFIRLLCHTSVLTLQMFIS-CRGLKVLVDLLDE
GK076_Glam       IFLMGLIPLANRL---------------------YSTYSTINEFLD-RWILPLLVKL-IS
GK077_Glam       ----------NSK---------------------FLTD-------E-REVLDHVVKL---


CDC15_Scer       --------------------------------------------------PTVGSSESHS
4322_Tthe        DVSKNKEIIQIGVDMLLML-S-EVQFLSYQ-NLC--------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  PYAESKRLVWMAVDAIVNV-F-ELQSPTPKNDFC--------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ----------------------QSIKPQISNDVN--------------------------
DDB0231212_Ddis  DYFNGFTLIHNSLDAISLI-F-KMNTASPKTALC--------------------------
CC1G_00852_Ccin  ------------SSPIGVV-GAHSESPPTAFKFK--------------------------
CC1G_05008_Ccin  DYGEQTELVEHALNGIGSV-F-ELQSPTTKNDFC--------------------------
GK076_Glam       EYEEDSAILQQRANHKTDMPT-DMAPLTGKQQTCGSQPSEVKSKEAGRRSTTT-KGNSYA
GK077_Glam       -YQLDSVL-----------PS-EKAVST-KNSRVGST-SAIQPAKSIMEIPTI-STQSYA


CDC15_Scer       VFLIKVNNDAAIEL----------------------------------------------
4322_Tthe        --RMLFKYD--ICQKLVLIFFGLVEEFVQRESQDQAAD----------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  --RLFSKCG--LLKTLPIVLRDSIADG-EAAA----------------------------
DDB0229915_Ddis  -----------MALAISVKVNQCY------------------------------------
DDB0229971_Ddis  --HL------------RSIMRDQI-ET-EYFQ----------------------------
DDB0231212_Ddis  --HLFAKTA--LMYRISYLLNQIFNSS-DKSATSKSQQFQQKQIQQQQQLLLQQQQQQQQ
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  --RMFIREG--LLDPLSAALLNVMSNH-EPASVDKS------------------------
GK076_Glam       VMRIFESMI--VTHTMSFILRFLFSPI-Q--------------------------TGHQS
GK077_Glam       TILITENAY---------------------------------------------------


CDC15_Scer       ---------------------------------------------PIDQL----------
4322_Tthe        --------------------------------------LKLIQK-CLDILL--LFAKC--
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ---------------------------------------TYPDR-IINLFI--MFSA---
DDB0229915_Ddis  -----------------------------------------QD-----------------
DDB0229971_Ddis  ---------------------------------------TFPDDNMVPRFIQRRFTHVDQ
DDB0231212_Ddis  QQQLLPSSSSPNLKFP---VLSKSSSVKNLSKDQFDKVLAYSVK-AADILL--FFST---
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ----------------------------------------TKMK-VIQILL--VFCQVSQ
GK076_Glam       KNSFIPTSTACDSLSLIMGKISDP-----------SHKAIEPHELAYNILL--ILFQ---
GK077_Glam       ---------------------------------------EYIAK-SLNILL--FWKL---


CDC15_Scer       ---------------------------------------------------VDLFYALND
4322_Tthe        EDKQMKINICQDETVQILI-----------------------------------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ADSVVRKTMSAVEVIRPIL-----------------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ANMMI-------------------------------------------------------
DDB0231212_Ddis  GDSLVKEEMSQSNVIKYIV-----------------------------------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  SDIHVRNALGTRKVIRRLL-----------------------------------------
GK076_Glam       SKTIFKS------------EILCEITSPDSPLLHTLMEH-VDKSIVYVFLLQDLLF----
GK077_Glam       LPPILEG--SPYNYPTCEVQVIGQRVDWNNPFDLDLSGETSDR-L------RSIFFADKG


CDC15_Scer       DDVNLSKL-----------------------ISIFTKICS--------------------
4322_Tthe        --------EIIDTLFQ---------QEEDPIFNQFLHLS----N----------------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  --------DTLSQLMP---------EQLAKVLKSIKQLS----M----------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  --------NVLDEIYTWKTIGNNIRSFLLKILKVIKNLS----M----------------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  --------RACELLDP---------ECLVQMLKAVKHLS----M----------------
GK076_Glam       ---IEAMRETVLALLP-------------RLFKKLQKMMDAYELMYT-AASHDEDDYDLS
GK077_Glam       KDYNETKLKYYLSILA-------------MNEKRIQALEQGIE-VYTKLVDLDY------


CDC15_Scer       ----------------------------------------------------L-PGFENL
4322_Tthe        ---------------EHT-LL--NKLENFGLIKRVLNLLDIE-SRKQKIDEVFLD-----
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ---------------DHN-TL--ANLQNAGAIRFMVPFLGRR-TG-AFVAEIH-N-----
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------P-----------------
DDB0231212_Ddis  ---------------DPN-VR--SRLDDAGVIPPLINYLKKH-GGIDKITEIH-N-----
CC1G_00852_Ccin  -----------------------------AAFKRSRSNLTPEPAKSPSSTPAP-Q-----
CC1G_05008_Ccin  ---------------NAT-LH--EVLQNANALEILIRILEEQ-SSGPHSTEMA-N-----
GK076_Glam       ASLHIDFSTFAAGIRTHNTNV--ANIIAIGSITTLEPDSLRY-NL-T---ILL-TAITNL
GK077_Glam       --AHIIFSKDV--LKTYINFISCVLMSCLPASYTASPLSNYS-ST-SLPYRIH-TIVTTF


CDC15_Scer       TI---NIIFHPNFYEKIVSF-FDTYFNSLLIQIDLLKFIKLIFS--KSLLKL-YDYTGQP
4322_Tthe        ----------------------------------------DLLKIINYFQNLS-------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ----------------------------------------HVLNTMFHLCRID-------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ----------------------------------------QALHSLYYLLLLD-------
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  ----------------------------------------HIFQTCYNLCRLS-------
GK076_Glam       LISLSKLVAEPYFSEPFKDH-IDVFVQVLSKSSDYGNAVPYALSSLHSLFRLNLDYIVNF
GK077_Glam       FASLRKFVLTPDFVQSLTSQTIDILVDLLINIQNYRTD--DILDSATYLCH----SIIQF


CDC15_Scer       DPIKQTEP------N-----------RRN-------------------------------
4322_Tthe        HP------RQEHLVLT-G----ALPILISIT-----------------------------
DDB0229877_Ddis  -----------NNSNN-NNNNNN-------------------------------------
DDB0229896_Ddis  PE------RQYQAAID-G----IIPHLQYFI-----------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  RS------RQEKALKS-S----ILEPLLTII-----------------------------
CC1G_00852_Ccin  -EPGPEEPRRRRPTLLSK----RPERPLSVT-----------------------------
CC1G_05008_Ccin  KS------RQEEAAQA-G----IIPCLKRVI-----------------------------
GK076_Glam       PRIKHIMT------NI-G----TILNCKE-------------------------------
GK077_Glam       PEIHAIAL------NK-G----LIPVCYRIIYGSLTPVIEGDASRPHSQRSSPRKPSKKM


CDC15_Scer       ----------------------KATVFKLRA---ILVQITE-------------------
4322_Tthe        ----------SNSAMSFSLR---------KISLSILCQFVKTSPLT-RK-----------
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ----------TSHS---PLN---------QFALPIICDLAHSK-KA-RS-----------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  ----------EERG---PLK---------ELALPILFDLVRSC-NN-RS-----------
CC1G_00852_Ccin  ----------SDSTNMSSLR---------SAAT---------------------------
CC1G_05008_Ccin  ----------ETS---SPLK---------QFALPILCDLASAGKSC-RT-----------
GK076_Glam       ----------------------AANIYSLQFAIPLALTITRTI-NP-NKFADKEIKHVLI
GK077_Glam       TSQAPEASSSYSPS---PITEFSGNVVEL--AMEIILRT-SAL-RPTKRFPN--------


CDC15_Scer       --------------FL---NN-------------NW---------------------NNG
4322_Tthe        KLMEHG-GPHIFLCFLQISEDCFKQ----------F---------------------SFK
DDB0229877_Ddis  ------------------------------------------------------------
DDB0229896_Ddis  ELWKNN-GVAFYLSLL---EERY------------W---------------------QVN
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  LLWKCN-TIDKLLDLI---EDRN------------W---------------------FAD
CC1G_00852_Ccin  ------------------------------------------------------------
CC1G_05008_Ccin  LLWQHD-GIGMYIRLL---DDPY------------F---------------------QVS
GK076_Glam       KEIKEN-FLLAFLDLI---ENSS-----------VW---------------------RKQ
GK077_Glam       QQKRQNRLMVPYQSLL---EKIFKEFSTVEDGREQWLSKIFNLAATYPNKVLCLLSWFFD


CDC15_Scer       CPKRNSN-QVGGDSVLICQLCEDIR-----------------------------------
4322_Tthe        ILDTLASWLVIDLEQIESFFLEN-------------------------------------
DDB0229877_Ddis  --------------NNNNNLNSGSNSFNNNSPISSFTNNNNNNESGDE----YDDDSDII
DDB0229896_Ddis  ALDSLAVWITDETHKVENIIATNENI----------------------------------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  AIESISTWATLESKLVFEKLNSGGTISPLTS-----TSTSTSTSKSSPSSSSSSSSSSLS
CC1G_00852_Ccin  ---------------AAESLNSGSGS----------------------------------
CC1G_05008_Ccin  AVESVLSWLQDETARVEDQLLKPYAV----------------------------------
GK076_Glam       CLDALAH-ILSYTNELESTICRDFRL----------------------------------
GK077_Glam       CSKYSH--IQQSWRRIINVIVSPANL----------------------------------


CDC15_Scer       -------SL---SKKGSLQ--KVS-SVTAA-----------------------I------
4322_Tthe        ---------LKFFIPSADNNISLL-QIIPI-----------------------IYRIISL
DDB0229877_Ddis  EDEQSS---------NSSL--SFN-NSNVPQVESVVVNV---QPPRV------------G
DDB0229896_Ddis  ------KKLIQLFTNAESQ--SFA-GILEP-----------------------LLKIIQI
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  TSTSTSSSSLQLPTSSSST--SFE-NHNIPLRLIGILNINHIKHPSFQKSIIPLFNLING
CC1G_00852_Ccin  ------RN----------------------------------------------------
CC1G_05008_Ccin  ------EALLKCFVNAKAN--SFE-NLLDP-----------------------FLKILRL
GK076_Glam       -------SL---SSSDYKE--TLP-SILTS-----------------------LLSLSEN
GK077_Glam       ------AKL---SVLLSTE--KIASEVIGD-----------------------LTRFIKQ


CDC15_Scer       -GSSP--TKDER-------SNL-RSSKD--------------------------------
4322_Tthe        SDKIAQVMACQEQFIESLCDLLTDFDDSNVQNTNTPQIK-KKILEFLHCILMRSTPQSIC
DDB0229877_Ddis  DE--CKVKC-GDGWYDAVVDLV-SGST--------FVVT-IKPFKIKREV----------
DDB0229896_Ddis  SIPVNILL-GTSNFITKIIDKLG-HTN--------PQVR-LNLLKIITSL----------
DDB0229915_Ddis  ------------------------------------------------------------
DDB0229971_Ddis  ------------------------------------------------------------
DDB0231212_Ddis  SQQLLKSLI-NEGLVNSLVECLRVDSS--------PVSK-ITLLKITASI----------
CC1G_00852_Ccin  ------------