Protein (view, download) , Domain (view, download)
FRAP_Hsap        MLGTGPAAATT----------------------------------A--------------
FRAP_Mmus        MLGTGPAVATA----------------------------------S--------------
B0261.2_Cele     MLQQHGISFQM---N-AD-------------------RQNKAATTSNR------------
TOR1_Scer        MEPHEEQIWKS-KLLKAAN--------------NDMDMDRNVPLAPNLNVNMNMKMNASR
TOR2_Scer        MNKYINKYTTPPNLLSLRQRAEGKHRTRKKLTHKSHSHDDEMSTTSNTDS----NHNGPN
Tor_Ddis         MSQHE-------------------------------------------------------
FRAP_Spur        MS----------------------------------------------------------
TOR_Dmel         MSTTS-------------------------------------------------------
CC1G_00894_Ccin  MASADQAP-----------------------------------VG---------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        MAGAQGVAP----------------------------------RP---------------
GK008_Glam       MSTDA-------------------------------------------------------


FRAP_Hsap        --------------------ATTS-SNVSVLQQFASGLKSRNEE----TRA-KAAKELQH
FRAP_Mmus        --------------------AATS-SNVSVLQQFASGLKSRNEE----TRA-KAAKELQH
B0261.2_Cele     ----IVSAPATNEFD----ERHRK-QGIDAARALASQYRSRITENRDANQR-QAARELSR
TOR1_Scer        NGDEFGLTSSRF-DGVV-IGSNGDVNFKPILEKIFRELTSDYKE----ERK-LASISLFD
TOR2_Scer        DSGRVITGSAGHIGKISFVDSELD-TTFSTLNLIFDKLKSDVPQ----ERA-SGANELST
Tor_Ddis         ---------------------QPS-IWADALTKLLNDLKSKKEE----DRV-KASKNLKS
FRAP_Spur        -----------------------------QMNSLVGGLKSRHDD----VRT-RAAKNLQH
TOR_Dmel         -----------------------------VVQQFVNGLKSRNRN----VQN-KATQDLLF
CC1G_00894_Ccin  ---------------------------DQQLNAIFSGLKSRSAD----TRM-QAAEDLKR
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ---------------------------PDALQRLLSELRFKTAS----IKDGAAAAALRK
GK008_Glam       ---------------------IT----SSRFYPYLADLKSIDPN----IYT-RAAMAIRM


FRAP_Hsap        YVTMELREMSQEESTRFYD-QLNH--------HIFE-LVSSSDANERKGGILAIASLIGV
FRAP_Mmus        YVTMELREMSQEESTRFYD-QLNH--------HIFE-LVSSSDANERKGGILAIASLIGV
B0261.2_Cele     YVRSELKDEPNTFSDAFLN-AIDGRTDIASQSAIYNCMKSNSNIDQKRAGIYLIVCLAET
TOR1_Scer        LLVSLEHELSIEEFQAVSN-DINN--------KILE-LVHTKKTSTRVGAVLSIDTLISF
TOR2_Scer        TLTSLAREVSAEQFQRFSN-SLNN--------KIFE-LIHGFTSSEKIGGILAVDTLISF
Tor_Ddis         YVISQSREMTNENFTKFMN-ELNNN-------LIFE-LVNSSVIPEKIGGIMAIDELIDV
FRAP_Spur        YVSTELREVSADERTSFMD-ELNH--------HIFE-LVSSQDVSEKKGGILAIVSLIGI
TOR_Dmel         YVKTELREMSQEELAQFFD-EFDHH--------IFT-MVNATDINEKKGGALAMKCLINC
CC1G_00894_Ccin  FVQVSYAEMTSDAAAKLWDDHINRR--------LFA-LIHSQNINEAFGGLLGIERLLEL
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        HVQEEARDLSAEGLTKFLD-ILYDR--------INC-LIESADVSDNLGALRAIDVLIDV
GK008_Glam       QVEKDSRQMLADPRTLFIS-DLMS--------FIRN-LATSSSYEDRLASLWVMRELIQS


FRAP_Hsap        EGG----NATRIGRFANYLRNLLP-SN---DPVVMEMASKAIGRLAMAGD--TFTAEYVE
FRAP_Mmus        EGG----NSTRIGRFANYLRNLLP-SS---DPVVMEMASKAIGRLAMAGD--TFTAEYVE
B0261.2_Cele     HS-------GNVIRYANYLLKMLN-NGNGLDEDTVKMASKALAFLIATCK--SYAAELVD
TOR1_Scer        YAYT-ERLPNETSRLAGYLRGLIP-SN---DVEVMRLAAKTLGKLAVPGG--TYTSDFVE
TOR2_Scer        YLST-EELPNQTSRLANYLRVLIP-SS---DIEVMRLAANTLGRLTVPGG--TLTSDFVE
Tor_Ddis         DYD---ENATKITRLANYLRIGLG-FN---DFTVMLMASKALGRLARSSG--TLTAEFVE
FRAP_Spur        DGD----NATRITRFANYLRNLLP-SN---DVVVMEMAAKAIGHLALAGG--TFTPEYVD
TOR_Dmel         EGSLT--ARKGISPYLNRLRDLLL-IN---DVSVMEIAARSLVKLANMPT--SKGADSFD
CC1G_00894_Ccin  DLEETIESKRNHFRFYNYVKHLLP-NP---DVHLMMAASKTLGKIAEIGGGVAFGERFME
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ELGES--A-TKTMKFANCVKRVLEEKQ---DPDVLVRASEVLGHIVSTG---PQTADIVE
GK008_Glam       RPT---ISMIPLTYFEEIALELVN-DP---SEVIILTNCVFIGRLINAEG--H-GIDFVP


FRAP_Hsap        FEVKRALEW-LGA------------DRNEGRRHAAVLVLRELAISVPTFFF--QQVQPFF
FRAP_Mmus        FEVKRALEW-LGA------------DRNEGRRHAAVLVLRELAISVPTFFF--QQVQPFF
B0261.2_Cele     RCLDHCHEW-LGQNVPHSQQPKNQQEIDQIRRLAASHLSRELALATPTAFF--LRVNLFF
TOR1_Scer        FEIKSCLEW-LTASTEKNS---FSSSKPDHAKHAALLIITALAENCPYLLY--QYLNSIL
TOR2_Scer        FEVRTCIDW-LTLTADNN----SSSSKLEYRRHAALLIIKALADNSPYLLY--PYVNSIL
Tor_Ddis         FEVTRALEW-LSG------------DRIEARRHAAVLVLKELAQNAPTLFY--VHASSFV
FRAP_Spur        FEVKRALEW-LGG------------DRQEGRRHAA-------------------------
TOR_Dmel         FDIKKAFEV-LRGE------------RQEYRRHSAVFILRELAIALPTYFY--QHILTFF
CC1G_00894_Ccin  YEIPAAIEL-MQPD------------KQEAPRYAGVLILKELARNSPTYFH--PHIGIVF
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        SQVSCALKW-LR---------------GESRRFAAVLILKEMADQAPTVFN--VHVPEFV
GK008_Glam       KLFVISIDKIKSGD--------------STKVYTGMLLFNDLTEVE-TSFAIDISSEEFL


FRAP_Hsap        DNIFVAVWDPKQ-AIREGAVAALRACLILTTQREPK-EMQKPQWYRHTFEEAEKGFDETL
FRAP_Mmus        DNIFVAVWDPKQ-AIREGAVAALRACLILTTQREPK-EMQKPQWYRHTFEEAEKGFDETL
B0261.2_Cele     KYIFNAVRDKNP-AVRIAGIDALHVVLTIVSQREAKN---KTEWFKKCFDEALEGQPNPS
TOR1_Scer        DNIWRALRDPHL-VIRIDASITLAKCLSTLRNRDPQ---LTSQWVQRLATSCEYGFQV--
TOR2_Scer        DNIWVPLRDAKL-IIRLDAAVALGKCLTIIQDRDPA---LGKQWFQRLFQGCTHGLSL--
Tor_Ddis         DLIWVALKDPKV-AIREGAVEALRACLELISERESR---LRLQWYQKIYDEAQKSFKQNG
FRAP_Spur        -----------Q-AIREAAVSALRACLELTAQRETK-EMQKPQWYKQTYEEAEKGFEETG
TOR_Dmel         EVIFNAIFDPKP-AIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADL
CC1G_00894_Ccin  DNILLPLRDPRL-HVREGAADLLANCLEIVCSRERQT---RNPYLYKILQDAQAGLKS--
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        DAIWIALRDPRQ-AIREHAVEALRACLTVIVTRETRW---RVRWYYRMFEATQDGLGKN-
GK008_Glam       EPIWHVITETRNSNIKEVGFKAINKFISY---QKKA-TK--HDVLVRLITMIRAALDG--


FRAP_Hsap        A---KEKGMN-RDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMG
FRAP_Mmus        A---KEKGMN-RDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMG
B0261.2_Cele     -------QKD-DLDRWHAVALILNELLRISDQRFELIRCESSQFIKQKFLKED-----EE
TOR1_Scer        ---------N-TLECIHASLLVYKEILFLKD-----------------------------
TOR2_Scer        ---------N-TNDSVHATLLVFRELLSLKA-----------------------------
Tor_Ddis         -----------SPESIHGSLITVSELLRNTG-----------------------------
FRAP_Spur        K---GEKGLN-RDDRAHGALLIINELIRTSSREGERLRQEMEEVSQQQTQHEHSFRDLGS
TOR_Dmel         GSSKDQKGVT-RDDRIHGGLVVFNELFRCANATWERRYTSLKTLFP-KTQHNKFLEASSS
CC1G_00894_Ccin  ---------S-QPEVIHGSLAAYRELLLHAG-----------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ---------A-TVESIHGSLLAVGELLRNTG-----------------------------
GK008_Glam       ------KNISEQLIALHL--LLNM------------------------------------


FRAP_Hsap        FGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTS----PSPAKSTLVESRC
FRAP_Mmus        FGTKPRHITPFTSFQAVQPQQPNALVGLLGYSSPQGLMGFGTS----PSPAKSTLVESRC
B0261.2_Cele     EG---------VE--------------------------------WLVLTKQQTIVESVT
TOR1_Scer        ------------------------------------------------------------
TOR2_Scer        ------------------------------------------------------------
Tor_Ddis         ------------------------------------------------------------
FRAP_Spur        SSNKAKS--P------TGPQLGHNQYVQRALASPLSLVATGIQ----PK---PRITESRY
TOR_Dmel         SSMG-------SQLNTLVPRLKVPFIDKL--GSTQTHLGEGEHHKGVAKFASHNVLESAY
CC1G_00894_Ccin  ------------------------------------------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------------------------------------------------------
GK008_Glam       ---------------------------------------------------LNLSVKDKS


FRAP_Hsap        CRDLMEEKFDQVCQWVLK----------CRNSKNSLIQMTILNLLPRLAAFRPSA--FTD
FRAP_Mmus        CRDLMEEKFDQVCQWVLK----------CRSSKNSLIQMTILNLLPRLAAFRPSA--FTD
B0261.2_Cele     ARKLVLERFPKILDCVRQIIPLANKTSSTKQQSSIYLNTVLMQLLPRICAFPQCDRTFQ-
TOR1_Scer        --PFLNQVFDQMCLNCIA----------YENHKAKMIREKIYQIVPLLASFNPQL--FA-
TOR2_Scer        --PYLRDKYDDIYKSTMK----------YKEYKFDVIRREVYAILPLLAAFDPAI--FT-
Tor_Ddis         --DFMLSKFKDICETVLK----------YKDHRDKLVKKTVLALFPRLAVFCSRD--FV-
FRAP_Spur        CLELMQENFDIVCQQVLK----------FCGSRNPLIQQILLNLLPRLAAFEPKM--FV-
TOR_Dmel         AQEILQEHYTSICDNVLE----------QRTSKSPYVQQALLQILPRLAAFNRAV--FV-
CC1G_00894_Ccin  --MFMQENFLDTAEAILR----------FKSSRDPLVRRMVITMIPTLAAYDTQT--FT-
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        --EFMMSRYKEVLDIAFK----------FRDHRDRLVRRSITSLLPRIAHFLRDR--FV-
GK008_Glam       IADYFQENYSSFFSLVAN----------IFRSKTSEGRMLVASIISLFAKLDPER--FCT


FRAP_Hsap        TQYLQDTMNHVLSCVK-KE---------KERTAAFQALGLLSVAVRS-EFKVYLPRVLDI
FRAP_Mmus        TQYLQDTMNHVLSCVK-KE---------KERTAAFQALGLLSVAVRS-EFKVYLPRVLDI
B0261.2_Cele     TISFDTSF----TIL-------------QRNAVAAPAIGMMMLSNPD-VHATHIEKTISF
TOR1_Scer        GKYLHQIMDNYLEILT-NAPANKIPHLKDDKPQILISIGDIAYEVGP-DIAPYVKQILDY
TOR2_Scer        KKYLDRIMVHYLRYLK-NIDMNA--ANNSDKPFILVSIGDIAFEVGS-SISPYMTLILDN
Tor_Ddis         LNYFNACMNHLLAALR-NQ---------NERPTAFIALGEIAMAVGG-SIKPYLDSIVVM
FRAP_Spur        TSYLEDTVKYMLISLR-RE---------RERSNAFQAVGLLAVAVKG-NITEHLGKILEI
TOR_Dmel         EKYLQTCVSHLMQILRGKE---------KDRTVAYITIGYMAVAVQS-AIEVHLSSIMTS
CC1G_00894_Ccin  EHFLHKAMAHLLTQLD-KA---------PERNFAFIAIGHTALAVGS-DMKPFLDPIMDN
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        TSYFTTSMDHLLAVMR-NP---------SERSTGFAALGEMAGAVGC-ALGEYLPAIMNF
GK008_Glam       TERLQMILTFYKKMIP-------------TQQELFIPLGEFVIVIGEKHVKPIFNDLINL


FRAP_Hsap        IRAALPPKD---------------FAHKRQKAMQVDATVFTCISMLARAMGPGIQQDI-K
FRAP_Mmus        IRAALPPKD---------------FAHKRQKTVQVDATVFTCISMLARAMGPGIQQDI-K
B0261.2_Cele     ISAAIK--------------------K--TTNSDVLDNYFTFLFLFVDAYHEQVTTQI-K
TOR1_Scer        IEHDLQTKF--------------------KFRKKFENEIFYCIGRLAVPLGPVLGKLLNR
TOR2_Scer        IREGLRTKF--------------------KVRKQFEKDLFYCIGKLACALGPAFAKHLNK
Tor_Ddis         IKQGLMTK--------------------G---KQFCPEVLTCISMLASAVGQSMYPHM-Q
FRAP_Spur        VRSSLPHKD---------------IPHRKHKSIIVDPAVFTCISMLARAVGPVIARDV-K
TOR_Dmel         VKVALPSKD---------------LTS--KRKVPVDPAVFACITLLAHAVKSEIADDV-K
CC1G_00894_Ccin  VRSCLQNRG--------------------RKNAPSEEPIFQCIGMLAAAVGPNLTKLL-H
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        IRDAVLYFSSVGFYILILYFFVCQLQP--RRGKP-SMEAIACVGNLTEALGPLMEEHV-R
GK008_Glam       ITSSFKSQN---------------FT---KAGSILPPEPLKCIQYITKGAPNLVQKHV-T


FRAP_Hsap        ELLEPM-LAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLR--------
FRAP_Mmus        ELLEPM-LAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLR--------
B0261.2_Cele     AIIPQL-MDITLSRSLANVLKMIMMRIPKLRLNVQDGVMASVYQTLTGSLIP--------
TOR1_Scer        NILDLM-FKCPLSDYMQETFQILTERIPSLGPKINDELLNLVCSTLSGTPFI--------
TOR2_Scer        DLLNLM-LNCPMSDHMQETLMILNEKIPSLESTVNSRILNLLSISLSGEKFI--------
Tor_Ddis         VILPQMIVSSGLTVVLTDALRDLTINLPTLIPNIQYKLLNLISQVLANKPFS--------
FRAP_Spur        ELLEPM-LAVGLSPALTAALHDLAKQIPQLKKDIQDGLLKMLSLVLMHKPLR--------
TOR_Dmel         DILEQM-FYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAI--------
CC1G_00894_Ccin  DQLDLM-LACGLSEPLSQALAAIAKYIPPLLKTIQDRLLQLLSMLLSGQPYR--------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        STLDIM-FDTGLTPTLEKALNQIVTSLPSFLPPIQERLLDFISLVLCKAPYF--------
GK008_Glam       SILECI-FSVGLCESLTSALQDLSANLHNRLLDIQGLLLYLVANELGGINLFLSNAYGVI


FRAP_Hsap        ---------------------------------HPGMPKGLAH-----------------
FRAP_Mmus        ---------------------------------HPGMPKGLAH-----------------
B0261.2_Cele     ---------------------------------PKSEP--IGR-----------------
TOR1_Scer        ---------------------------------QPGSPMEIPS-FSR-----------ER
TOR2_Scer        ---------------------------------QSNQYDFNNQ-FSI-----------EK
Tor_Ddis         ---------------------------------EPGAPSPYRK----------------S
FRAP_Spur        ---------------------------------HPGTPRALLS-----------------
TOR_Dmel         ---------------------------------LPYT-----------------------
CC1G_00894_Ccin  ---------------------------------PLGAPAPLGR----------------N
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ---------------------------------SQRKSLLV-------------------
GK008_Glam       DGSEDYYLVLTENQSQAVADGHDSGVLDSQTSIIPGTRPSTTQATTHVEDTRTNEDAIEL


FRAP_Hsap        --QLASPG---------------------------------------LT----TLPEASD
FRAP_Mmus        --QLASPG---------------------------------------LT----TLPEASD
B0261.2_Cele     --PASPKA---------------------------------------I--LQKAETDPKE
TOR1_Scer        AREWRNKN---------------------------I-----------LQKTGESNDDNND
TOR2_Scer        ARKSRNQS---------------------------F-----------MKKTGESNDDITD
Tor_Ddis         ATPFQGGS---------------------------------------IPQ--LGQNSDVD
FRAP_Spur        --PTGQTG---------------------------------------TA---LSSIDSGD
TOR_Dmel         ---ALPTI---------------------------------------A--IDGSLMQNGD
CC1G_00894_Ccin  EFPAPPNQ---------------------------------------LT-ATQMTTTDKN
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ---RLPQK---------------------------------------A--VGLPSSEIQG
GK008_Glam       AHDLSITGLKEESEQCDFKNSLSVYQTVTTSAGITALYKLSDRIATALGTSKLRPRRHST


FRAP_Hsap        VGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHL-I
FRAP_Mmus        VASITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHL-I
B0261.2_Cele     LQRIVLAVDVLGEFYFSRGALQRIMQYVADYYLTADNVEIRLAAVSSCCEMVVPFVGV-Y
TOR1_Scer        IKIIIQAFRMLKNIK-SRFSLVEFVRIVALSYIEHTDPRVRKLAALTSCEIYVKDN----
TOR2_Scer        AQILIQCFKMLQLIH-HQYSLTEFVRLITISYIEHEDSSVRKLAALTSCDLFIKDD----
Tor_Ddis         PQMIALALKTLGSFDFSKHNLLEFVRECVVNYLDDDNIEIRREAAITCAQLMVGTE----
FRAP_Spur        LTSTVLALRTLGNFDFEGHSLTQFVRHCADHFLSSEHKEIRIEAARTCSSLLQPAVNV-S
TOR_Dmel         GATTVLALKTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLEAVQTCTRLLKLAVQ---
CC1G_00894_Ccin  SELITLALKTLGTFDFSGHVLNEFVRSCALPYLEDDNPQVRCAAAETCCTLFIKD-----
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        PALVQLALKILTNFNFKGHDLLEFAREAVVMHLEDDDAGVRRHAARCCCRLVEHSYQ---
GK008_Glam       SEAILLAFQALYDFDFSLFDLTIFAADYLTRYLRNDSSTLRIKAAQTILKLMSEDHFEKI


FRAP_Hsap        SG--------------------------------------------HA------------
FRAP_Mmus        SG--------------------------------------------HA------------
B0261.2_Cele     KK--------------------------------------------VT------------
TOR1_Scer        ----------------------------------------------IC------------
TOR2_Scer        ----------------------------------------------IC------------
Tor_Ddis         ----------------------------------------------EP------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         SS--------------------------------------------ES------------
CC1G_00894_Ccin  -P--------------------------------------------IC------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        TA--------------------------------------------IT------------
GK008_Glam       RRGKHSQYKSMTIKAEDCHSWAGSTLGEAPTPSGGATIIPPAVVSNQSFATTISPKTRHI


FRAP_Hsap        -HVV------------S--------------------------------------QTAVQ
FRAP_Mmus        -HVV------------S--------------------------------------QTAVQ
B0261.2_Cele     -SDK------------R--------------------------------------NSLLQ
TOR1_Scer        -KQT------------S--------------------------------------LHSLN
TOR2_Scer        -KQT------------S--------------------------------------VHALH
Tor_Ddis         -TPT------------R--------------------------------------GHSAV
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         -MEN------------S--------------------------------------KTLSD
CC1G_00894_Ccin  -YQA------------S--------------------------------------SHAIE
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        -GRSASRLTSGRPLTFR--------------------------------------KHR-I
GK008_Glam       RTHS------------SSHLDDMSSTSFCINQDCILSQDILKSSDLGTDGFFNSGPYRHM


FRAP_Hsap        VVADVLSKLLVVGITDPDPDIRYCVLASLD---ERFDAHLAQAENLQALFVALNDQVFEI
FRAP_Mmus        VVADVLSKLLVVGITDPDPDIRYCVLASLD---ERFDAHLAQAENLQALFVALNDQVFEI
B0261.2_Cele     TIYGVLRAVCSVIVNDQDVRVRMQVISCFGQMPRPFLAHLAQPEMLEVQFMALHDEKLEM
TOR1_Scer        TVSEVLSKLLAITIADPLQDIRLEVLKNLN---PCFDPQLAQPDNLRLLFTALHDESFNI
TOR2_Scer        SVSEVLSKLLMIAITDPVAEIRLEILQHLG---SNFDPQLAQPDNLRLLFMALNDEIFGI
Tor_Ddis         IVGEVLEKLLVVGIADPDPSIRKTVLSSLE---ARFDHYLAQAENLRSLFIALNDELFEI
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         TVSHVIERLLMVAITDMDCNVRIRILRSLD---ETFDGKLAQPESLNSLFITLHDEIFEI
CC1G_00894_Ccin  VISDVLDKLLTVGIADPDPGIRNVVLRGLH---ERFDKHLAQAENVRSLFIALNDEVMAN
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        LIEEILEKLLVAAVSDTDASVREDVFVSLGT-NGSFYDFLAQADCLKAIFIAFNDQSFEV
GK008_Glam       LISDTLRQIIIIGTTDIDPEVRMSIIQALTT-TNRYDIYLVHESSLRTLFIALYDDNIEI


FRAP_Hsap        RELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRL
FRAP_Mmus        RELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRL
B0261.2_Cele     QQACVTLLGRLAELNPALVLPRLRLMLLETLSQMQQSGQARLEQHSAKMIAQLAKQSPKF
TOR1_Scer        QSVAMELVGRLSSVNPAYVIPSIRKILLELLTKLKFSTSSREKEETASLLCTLIRSSKDV
TOR2_Scer        QLEAIKIIGRLSSVNPAYVVPSLRKTLLELLTQLKFSNMPKKKEESATLLCTLINSSDEV
Tor_Ddis         RELAITVIGRLTIRNPAYVMPSLRKTLIQLLTELEFSGDGRNKEESARLLGHLISASEKL
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         RELAMVTIGRLSSINPAYVMPKLRTTMIELITDLKYSGMSRNKEQSAKMLDHLVISTPRL
CC1G_00894_Ccin  REAAVGLIGRLAKHNPAYVMPSLRKALIQLLTELEYSTVMRNREDCTRLLTLLVSATQRL
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        RKLSIVMAGKLSDKNAAYVCPALRRHLQQLLTDMEHSADSKSKEESAILLGSLIRACETL
GK008_Glam       RILAVKLIGRLCSLNPALVTPEIRHLILVLLTELRLTTENNKRATSNELIVKIFKFCGSI


FRAP_Hsap        IRPYMEPILKALILKLKDPD-PDPNPGVINNVLATIGELAQVSG--LEMRKWVDELFIII
FRAP_Mmus        IRPYMEPILKALILKLKDPD-PDPNPGVINNVLATIGELAQVSG--LEMRKWVDELFIII
B0261.2_Cele     MRPYVGSLMIAMIPKLRNDQ---KYAEVTAQVLNAVSEIAVIGG--AEIVKNLKPLFEKL
TOR1_Scer        AKPYIEPLLNVLLPKFQDT-----SSTVASTALRTIGELSVVGG--EDMKIYLKDLFPLI
TOR2_Scer        AKPYIDPILDVILPKCQDA-----SSAVASTALKVLGELSVVGG--KEMTRYLKELMPLI
Tor_Ddis         IKPYVEPILKALLPKLRDS-----NPRVASCVLAALGELSVVGG--EEMVQHIDSLLPLI
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         ISSYMNPILKALVPKLHEPE---SNPGVILNVLRTIGDLAEVNGGSDEMELWADDLLSIL
CC1G_00894_Ccin  IKPYAIPMLRVLLQKANDP-----NPAVAANVLMCLGELACVAG--EDAMPHVQELMQII
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ITPYVIPIHKALVARLSEGSGGSGNIGVVSGVMATVGELARVAG--CAIRPHIKDLMPLI
GK008_Glam       VLPYVPMVYSAVMGLISKDC--D-DEYLLITSLTTLAELFTIGS--TSMVHCLAEVIPLL


FRAP_Hsap        MDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFL-KTEQNQGTRRE
FRAP_Mmus        MDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFL-KTEQNQGTRRE
B0261.2_Cele     THMINDSSSLHKREAALRAIGGICRSTAYVVDPYRDYPSLLDDLLRIL-KTVMSNTMRRE
TOR1_Scer        IKTFQDQSNSFKREAALKALGQLAASSGYVIDPLLDYPELLGILVNIL-KTENSQNIRRQ
TOR2_Scer        INTFQDQSNSFKRDAALTTLGQLAASSGYVVGPLLDYPELLGILINIL-KTENNPHIRRG
Tor_Ddis         IDTLQDQSSTSKREVALKTLAQLASSTGYVIKPFSKYPMLLDTLLNAI-KTERIGSIRRE
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         LEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKYPVLIDILINFL-KTEQRRSIRRE
CC1G_00894_Ccin  LAKLADPQT-LKRDAALHALGQVCSSTGYVVQPLLDHPQLLPLLGRIM-RTETSVQTRRE
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        VDALRDTSAASKRDVAVRTLGQLVQNTGYVVTPYTEFPHLLGLLLRILLNGELEWSTRNE
GK008_Glam       ITCIKEETSKTLRLTTTRCFVRIVEATSFVVFPWFIYHDLFTIVFGIL-KNDTSQEIRLE


FRAP_Hsap        AIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLS-------------------------
FRAP_Mmus        AIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLS-------------------------
B0261.2_Cele     AIKTLGILGAIDPYTHKVFTGSVQSS-TAISTALS-------------------------
TOR1_Scer        TVTLIGILGAIDPYRQKEREVTS--T--------T-------------------------
TOR2_Scer        TVRLIGILGALDPYKHREIEVTS--N--------S-------------------------
Tor_Ddis         VIKVLGILGSLDPYKHKMNELGK-RR--------E-------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         TIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYS-------------------------
CC1G_00894_Ccin  VVKVLGILGALDPYRRKSRPDEDVAS-N------A-------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        VLKVLGVIGALDPHVNKRNELRLHPS-DGNRSSLS-------------------------
GK008_Glam       AAKLITTIGAIDPIFYQNGKPDL--SALVPPTNLTCKCQSTDVFSLDYIMDESNIWVCHK


FRAP_Hsap        -ESKSSQDSSDYSTSEML------------------V--NMG-NLPLDEFYPAV--SMVA
FRAP_Mmus        -ESKSSQDSSDYSTSEML------------------V--NMG-NLPLDEFYPAV--SMVA
B0261.2_Cele     -LPISETDSKDPRQDIIH------------------W--FNYEKCTLEEFYPAI--TIAN
TOR1_Scer        -D--ISTEQNAPPIDIAL------------------L--MQGMSPSNDEYYTTV--VIHC
TOR2_Scer        -K--SSVEQNAPSIDIAL------------------L--MQGVSPSNDEYYPTV--VIHN
Tor_Ddis         -DPKANDDKNNNMTNE-V------------------I--TI--SPSNEDYYPTV--ALTA
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         -DGKVD-ESQDIST--AE------------------L--LVNMGNALDEYYPAV--AIAA
CC1G_00894_Ccin  -ETSVA-AVN----QVPI------------------N--PHPTSSSSDDYFQTV--VITS
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        -ETVHG-QTNDESLMEAW------------------P--TGGISAATEDYYSTVKVAINA
GK008_Glam       GEGGAAQEASIKSHGKAVVSPITGHVVENVYIMKLDSGSEVSANVSDFELTLNV--IMST


FRAP_Hsap        LMRIFRDQSLSHHHTMVVQAITFIFKS-LGLKCVQFLPQVMPTFLNVIRVC-----DGAI
FRAP_Mmus        LMRIFRDQSLSHHHTMVVQAITFIFKS-LGLKCVQFLPQVMPTFLNVIRVC-----DGAI
B0261.2_Cele     LMLMMQDEDSQ-SYAEIAQAIVTIFRS-LGDMAPLYTEQVIPRLIEVCRRATESSNRANL
TOR1_Scer        LLKILKDPSLSSYHTAVIQAIMHIFQT-LGLKCVSFLDQIIPTILDVMRTC-----SQSL
TOR2_Scer        LMKILNDPSLSIHHTAAIQAIMHIFQN-LGLRCVSFLDQIIPGIILVMRSC-----PPSQ
Tor_Ddis         LMKILRDPSLSSHHTSVIQAVMYIFKS-LSLKSIPFLPQIMPPFLHAMNTG-----EPLF
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         LMRILRDPTLSTRHTSVVQAVTFIFQS-LGIKCVPYLAQVLPNLLDNVRTA-----DNNL
CC1G_00894_Ccin  LLAILKDQSLSSHHHTVIEAIMSIFKT-QGLKCVTFLPQIIPAFAAITRTS-----IARL
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        LMRTLRDPSSSIYHQSVVKSLMYIC-------------KVMPDLLLTIRNC-----EDNL
GK008_Glam       LYSILSESTLDMYHYDAVVVFRTIIQTECTAISLPMVPKIISLILENIQNC-----KVFM


FRAP_Hsap        REFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMN---TSIQSTIILLIEQIVVALGG
FRAP_Mmus        REFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMN---TSIQSTIILLIEQIVVALGG
B0261.2_Cele     REFFLQQLANFVAIIRKHAAPYMPAIFTIIADAWKED---ISVKMVVIEVLTDMGTAIGN
TOR1_Scer        LEFYFQQLCSLIIIVRQHIRPHVDSIFQAIKDFSSV----AKLQITLVSVIEAISKALEG
TOR2_Scer        LDFYFQQLGSLISIVKQHIRPHVEKIYGVIREFFPI----IKLQITIISVIESISKALEG
Tor_Ddis         REFLFQQLGSLVSIVKQHIRDYLVNVFALIEKYWNS-----NLLIPIIKLVEEISSALND
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         REFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTIN---TPLQNTLINLIEQIAVALGC
CC1G_00894_Ccin  QEFHLQQLAILVGIIKQHIRNYTLDVFSLITELWD-N---VTLQLPIVALIEALGKALDA
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        REFIFCQLADLVAIVRQHIRKYLSSILSLVLDMILPTSPRSASHSPILHLVERLCVALHD
GK008_Glam       QETMLRELILIISSIGHHAHSYVSDIFDIIEVLWAN----QQLIELILALLEEVSIVLDL


FRAP_Hsap        EFKLYLPQLIPHMLRVF---MH-DN---SPGRI-VSIKLLAAIQLFGANLDDYLHLLLPP
FRAP_Mmus        EFKLYLPQLIPHMLRVF---MH-DN---SQGRI-VSIKLLAAIQLFGANLDDYLHLLLPP
B0261.2_Cele     DFSKYTGELIPYLLTVL---QT-DK---TKERV-LTVKVMESIQKLTHCIVQHLHLVLPP
TOR1_Scer        EFKRLVPLTLTLFLVIL---EN-DK---SSDKV-LSRRVLRLLESFGPNLEGYSHLITPK
TOR2_Scer        EFKRFVPETLTFFLDIL---EN-DQ---SNKRI-VPIRILKSLVTFGPNLEDYSHLIMPI
Tor_Ddis         EFKVYLPNLIPQMLNVL---HT-DR---SPKRS-PTTKVLRALEVFGTNLDDYLHLVIPA
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         EFRDYLAELIPQILRVL---QH-DN---SKDRM-VTRRLLQALQKFGSTLGYYLPLILPP
CC1G_00894_Ccin  EFKPFLPTILPLVLKVF---DG-DT---SDKRIAVQIKIFDAFLTFGANIEEYLHLVIPI
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        EFRMHMPEILPKCIQAL---NEAER---NADYA-YVASLLHTFEVFGASLDEHMHLVLPA
GK008_Glam       SLGNYGSQFFLKFVGLFTVLKS-SQEISDSAKK-LLIRACRSVVALSSLFSNHIHLIVDL


FRAP_Hsap        IVKLFD--APEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQ--S-------
FRAP_Mmus        IVKLFD--APEVPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQ--S-------
B0261.2_Cele     LLIILD--DFSLKLSIRNTALSTVLHMTQQVDVSAYAPRMMQSWHHNIS---T-------
TOR1_Scer        IVQMAE--FTS--GNLQRSAIITIGKLAKDVDLFEMSSRIVHSLLRVLSSTTS-------
TOR2_Scer        VVRMTE--YSA--GSLKKISIITLGRLAKNINLSEMSSRIVQALVRILNNG-D-------
Tor_Ddis         IVKLFE--QVDVTTQVRTLAIQTIGRLCKKLNFSDYASRIIHPLARVLDST-E-------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         IVKLFD--SPYVPQQVSMVALETINNLACQLDFTDFSSRIIHPLVRVLDA--E-------
CC1G_00894_Ccin  IVKSYE--RSDAPSSLRKRAIQTIDGLSRRVNFSDHASRIIHPMVRVLDGN-N-------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        LVRLFKPDVSNAPMDIRRSTIKTFSRLLPCMQVTAHVSSLLHPLLSVLDGT-K-------
GK008_Glam       LCSGIR--KQKLGKELRFALLDTLSRLTICTNLSRFGASIIHPILEVIMEADPCTSVEHN


FRAP_Hsap        ------------PELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
FRAP_Mmus        ------------PELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
B0261.2_Cele     ------------AEMRDKLLLLLIEIIKQLGKFFDIFKRGVDQKLRDYNLDKSVHYEQYR
TOR1_Scer        ------------DELSKVIMNTLSLLLIQMGTSFAIFIPVINEVLMKKHIQHTIYDDLTN
TOR2_Scer        ------------RELTKATMNTLSLLLLQLGTDFVVFVPVINKALLRNRIQHSVYDQLVN
Tor_Ddis         ------------SELREETLNTLCALVYQLGSDYAIFIPMVGKVLARREIQSTNYELLIS
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         ------------PELRDQAMTTLRSLAKQLGKKYLVFVPMVQRTLNKHRIVDPEYEELLS
CC1G_00894_Ccin  ------------NELRMAVFDTLCSLVAQLGSDFAIFVPTINKATLRNRISHPRYENLVS
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------DELRNDAVDAICVLATVLGAEFTMFLPSVRKLLQRHHLQHPQFDSIES
GK008_Glam       KNANPEKGLNPMNIVSYKAFEVLHFICAQFGVSVTLYIPVITECLLKVGFTSGLLDSIFS


FRAP_Hsap        RIVKGYTL-----ADEEE--------DP--------------------LIY---------
FRAP_Mmus        RIVKGYTL-----ADEEE--------DP--------------------LIY---------
B0261.2_Cele     KLAQRAQMSRDVLTSSVFAGS-----NG--------------------NIQYSSTQAGMR
TOR1_Scer        RILNNDVL-----PTKILEAN-----TT--------------------------------
TOR2_Scer        KLLNNECL-----PTNIIFDK-----EN--------------------------------
Tor_Ddis         KLLKNQQL-----MLTPGSGD-----DG--------------------GMGANRFG----
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         KIKSCSTL-----ADSYGAG------ES--------------------ELRPS-------
CC1G_00894_Ccin  KLLNGESL-----PSEAGGM------D---------------------WIQA--------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        RLKRRDPILVDVRPTAVS--------EA--------------------DIAAS-------
GK008_Glam       LLLRREEV-----DPVTFYRLICEWKKKQAKKFSEYTSLASLLAMYETPVTQDTLL----


FRAP_Hsap        -----------------------------------Q--HRMLRS----GQGD--------
FRAP_Mmus        -----------------------------------Q--HRMLRS----SQGD--------
B0261.2_Cele     GQANNVYANNDLHERLMNGSIDSGASRQDNRDDYYRYGVEEKKEVPKVAPTT--------
TOR1_Scer        -----------------------------------D-----YKP----------------
TOR2_Scer        -----------------------------------------EVP----------------
Tor_Ddis         --------G--------------------------D--HNGHHL----GEDH--------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         -----------------------------------RF--KNN------------------
CC1G_00894_Ccin  ---------------------------------------ENS------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        -----------------------------------SHG----------------------
GK008_Glam       --------Y--------------------------M--ESISNK----VPGDDKDAMILV


FRAP_Hsap        -------------------------ALASGPVETGPMKKLHVSTI--------NLQKAWG
FRAP_Mmus        -------------------------ALASGPVETGPMKKLHVSTI--------NLQKAWG
B0261.2_Cele     -------------------------ARPTSELVTVQITKQRLNKD--------ALMPQWK
TOR1_Scer        -------------------------AEQMEAAD-AGVAKLPINQS--------VLKSAWN
TOR2_Scer        -------------------------ERKNYEDE-MQVTKLPVNQN--------ILKNAWY
Tor_Ddis         -------------------------NNTSTPLD-IGVKKLKANEQ--------HLKNAWE
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         --------------------------EPFVTDRNSNNKNLQVTTN--------ELRTAWQ
CC1G_00894_Ccin  --------------------------KAQEFQAPAEAPKMTVNQQ--------HLKQAWD
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        --------------------------AELDGENALSTRGTQV------------------
GK008_Glam       VKDINFDDIGSVINYLHTSSTWFGDDMRPLPAGAIGVHSLSIQENDMLNKHVTIPQQIWR


FRAP_Hsap        AARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELN
FRAP_Mmus        AARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELN
B0261.2_Cele     NENLTSKDEWLQWLMKIRIGFLTYGSSPSLRAASSLGDQHPHLARDLFPAAFMSVWTELD
TOR1_Scer        SSQQRTKEDWQEWSKRLSIQLLKESPSHALRACSNLASMYYPLAKELFNTAFACVWTELY
TOR2_Scer        CSQQKTKEDWQEWIRRLSIQLLKESPSACLRSCSSLVSVYYPLARELFNASFSSCWVELQ
Tor_Ddis         TSQRSTKEDWGEWIRRFSVELLRESPSPALRSCLSLAQDYHPLVKELFNAGFVSCWTELH
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         VTRRVSKDDWVEWLKRLSIGLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELS
CC1G_00894_Ccin  VSQVTTKDDWLEWMHRLSVEFMKESPSHALRACMTLVDIHQPLAKELFNAAFLSCWTELY
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        --------------------------------------NEPHVARELFAVAFVSCWSQLN
GK008_Glam       ADTCKKNEEWRHWLSNLSLTLLQCSPLKCLRACHKLATSYPRVARDLFNYSFLACLSETY


FRAP_Hsap        E---DQQDELIRSIELALTSQDI-AEVTQTLLNLAEFMEHSDKG-PLPLRDDNGIVLLGE
FRAP_Mmus        E---DQQDELIRSIELALTSQDI-AEVTQTLLNLAEFMEHSDKG-PLPLRDDNGIVLLGE
B0261.2_Cele     S---DVQNDLTSCLLRAIS-TGI-PELIQTILNLAEFMDHSEKG-PLPISH----DVLGR
TOR1_Scer        S---QYQEDLIGSLCIALSSPLNPPEIHQTLLNLVEFMEHDDK--ALPIPT----QSLGE
TOR2_Scer        T---SYQEDLIQALCKALSSSENPPEIYQMLLNLVEFMEHDDK--PLPIPI----HTLGK
Tor_Ddis         E---QFQEELVRSLETALLSPNIPPEILQTLLNLAEFMELHEK--PLPIDI----RTLGA
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         P---DLKNELTQSLIQALQVTDM-PEITQTILNLAEFMEHCDRD-PIPIET----KLLGT
CC1G_00894_Ccin  D---QYQEDLVRSIEFAITSTTAPPELIHRLLNLAEFMEHEEK--PLPIEH----RTLGE
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        D---SYKKQLVRSLNYALTSPNIPSDILGTLLNLAEFMERDED--PLPVDT----RTLGS
GK008_Glam       PSNNEHRNYIVESIRSVFLSQNCPLDVLQILLDLAEFWENRSREFSTTFSH----NFLGE


FRAP_Hsap        RAAKCRAYAKALHYKELEFQKGPT-------------PAILESLISINNKLQQPEAAAGV
FRAP_Mmus        RAAKCRAYAKALHYKELEFQKGPT-------------PAILESLISINNKLQQPEAASGV
B0261.2_Cele     WAEQTKAFAKACRYKEMSVLKKSGSMQTTFTRKVKLEPNDCQSLITYANKLNVQEEAAGV
TOR1_Scer        YAERCHAYAKALHYKEIKFIKEPE-------------NSTIESLISINNQLNQTDAAIGI
TOR2_Scer        YAQKCHAFAKALHYKEVEFLEEPK-------------NSTIEALISINNQLHQTDSAIGI
Tor_Ddis         LAEKCHAYAKALHYKESEFSQSPS--------------STIEALISINNQLQQPEAAIGI
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         RAMACRAYAKALRYKEEEFLLRED-------------SQVFESLILINNKLQQREAAEGL
CC1G_00894_Ccin  YANKYMAYAKALHYKEMEYFAESS-------------PAVIESLISINTKLQQHDAAWGT
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        LAEKCHLFAKALHYKEMEFDMVLAREQ------KHQLVGAVEALIHVNNQLHQHEAAVGI
GK008_Glam       VAERCHAYTRSLRYKETEYAQHPI-------------E-AVGRLIAINYSLGYEETAIGT


FRAP_Hsap        LEYAMKHFG---------------------------------------------------
FRAP_Mmus        LEYAMKHFG---------------------------------------------------
B0261.2_Cele     VRYAERNEM---------------------------------------------------
TOR1_Scer        LKHAQQHH----------------------------------------------------
TOR2_Scer        LKHAQQHN----------------------------------------------------
Tor_Ddis         LIYAQKNH----------------------------------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         LTRYRNAAN---------------------------------------------------
CC1G_00894_Ccin  LLHAREQ-Y---------------------------------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        LTYAQRN-L---------------------------------------------------
GK008_Glam       LRVECKRLNFISTNLIYDILLRCLYTGLDDVFTMMQREGGLEPGAAVNCSAESTLERIIN


FRAP_Hsap        ------------------------------------------------------------
FRAP_Mmus        ------------------------------------------------------------
B0261.2_Cele     ------------------------------------------------------------
TOR1_Scer        ------------------------------------------------------------
TOR2_Scer        ------------------------------------------------------------
Tor_Ddis         ------------------------------------------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         ------------------------------------------------------------
CC1G_00894_Ccin  ------------------------------------------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------------------------------------------------------
GK008_Glam       KVVSKIVTKALTEAKKISNLNQSIPQQLVSYGSIGGIFVEGRPVMSGPEGSVLQVDYNEI


FRAP_Hsap        -----------------------------------------------E-LEIQATWYEKL
FRAP_Mmus        -----------------------------------------------E-LEIQATWYEKL
B0261.2_Cele     -----------------------------------------------N-FQMRGRWYEKL
TOR1_Scer        -----------------------------------------------S-LQLKETWFEKL
TOR2_Scer        -----------------------------------------------E-LQLKETWYEKL
Tor_Ddis         -----------------------------------------------S-VELKEGWYEKL
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         -----------------------------------------------E-LNVQGRWYEKL
CC1G_00894_Ccin  -----------------------------------------------D-VTKHEEWYERL
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        -----------------------------------------------G-VQLKESWQVF-
GK008_Glam       GIYLSALARRMLKSKLTYQYPTFLMYEENLFQSVLKTLRYKAQGHMQDLYGPSPKWFENV


FRAP_Hsap        HEWEDALVAYDKKMDTNK-----------D-----------DPELMLGRMRCLEALGEWG
FRAP_Mmus        HEWEDALVAYDKKMDTNK-----------E-----------DPELMLGRMRCLEALGEWG
B0261.2_Cele     NEWEKALGAYELEEKKKSSCPNLQVYDEKDHLMTPEE-AATAEEARMHEMRCLEALGRWD
TOR1_Scer        ERWEDALHAYNEREKAGD-----------T-----------SVSVTLGKMRSLHALGEWE
TOR2_Scer        QRWEDALAAYNEKEAAGE-----------D-----------SVEVMMGKLRSLYALGEWE
Tor_Ddis         RRWEDALAAYEKKQKDDPNG---------G-----------TIENTMGILRCLHALGEWE
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         HNWDEALEHYERNLKTDSS----------------------DLEARLGHMRCLEALGDWS
CC1G_00894_Ccin  GRWQEALQVYDRKAMEDPD----------------------SPEVKIGRVKCYHALGEWE
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------AVA---------------------T-HILQKIMVVGRMRCLVALARWE
GK008_Glam       CLWDKALSGYNRQIDQLKLSLKSNT----S---EARTLLPMLVNLTKDKIRCLFALADYS


FRAP_Hsap        QLHQQCCEKWTL-------------VNDETQ--------------AKMARMAAAAAWGLG
FRAP_Mmus        QLHQQCCEKWTL-------------VNDETQ--------------AKMARMAAAAAWGLG
B0261.2_Cele     ELNSKSV-VWADQRGNRNDSVRDEINKKQLD--------------HKMAVIAARGAWAVD
TOR1_Scer        QLSQLAARKWKV-------------SKLQTK--------------KLIAPLAAGAAWGLG
TOR2_Scer        ELSKLASEKWGT-------------AKPEVK--------------KAMAPLAA-AAWGLE
Tor_Ddis         RLSALSSETWKSD------------INDHTR--------------ATIAPLAAAAAWNLV
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         ELSNVTKHEWEN-------------FGTEAK--------------SRAGPLAAVAAWGLQ
CC1G_00894_Ccin  LLAAQVQENWAN-------------ATNEER--------------REMAPMAAAAAWSLN
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ELSTLCRETWSE---------------PSAQ--------------LQMAPMAASAAWNMG
GK008_Glam       AVQEEADQLLNY-------------LSSESKEEAGLTTVKHTLIKGFQADIATYAAWSLL


FRAP_Hsap        QWDS--MEEYTCMIPRDT---------------HDGAFYRAVLALHQDLFSLAQQCIDKA
FRAP_Mmus        QWDS--MEEYTCMIPRDT---------------HDGAFYRAVLALHQDLFSLAQQCIDKA
B0261.2_Cele     NWER--MADYVSVISENT---------------QDGAMLRAVVAVHNDENTKAMGLIEKV
TOR1_Scer        EWDM--LEQYISVMKPKS---------------PDKEFFDAILYLHKNDYDNASKHILNA
TOR2_Scer        QWDE--IAQYTSVMKSQS---------------PDKEFYDAILCLHRNNFKKAEVHIFNA
Tor_Ddis         NWDK--MDEYVCAMNKDT---------------VEGSFYRAILEVHHDNFTLAHGFIDHA
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         DWEA--MREYVRCIPEDT---------------QDGSYYRAVLAVHHDDFETAQRLIDET
CC1G_00894_Ccin  DWDS--MDNYIGTMKNDS---------------PDRAFYRAILSVHQNQFSKALAHIAKA
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        EWDE--MEEYVSQMDNGDEMNVPTRGQDGTGTGFAGAFFRAVLCIRRSKYDEAGIYAERA
GK008_Glam       EQDQEDVEIWLRVLPEDN---------------IDGTIIRATSYIKANKMLEAHKLLCKL


FRAP_Hsap        RDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLV-------------------
FRAP_Mmus        RDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLV-------------------
B0261.2_Cele     REMIDSELTAMANESYERAYIPMVSVQQMAELEEAIEYKTRP------------------
TOR1_Scer        RDLLVTEISALINESYNRAYSVIVRTQIITEFEEIIKYKQLPP-----------------
TOR2_Scer        RDLLVTELSALVNESYNRAYNVVVRAQIIAELEEIIKYKKLPQ-----------------
Tor_Ddis         RTLVDTELTALLGESYNRAYKVVVRLQQLSELEEIIEYKKCVD-----------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         RDLLDTELTSMAGESYERAYGAMVCVQMLAELEEVIQYKLIP------------------
CC1G_00894_Ccin  RELIDPELSSFTGEGYGRSYNVMVRAQMLSELEEIIAYKQYA------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        RKCLATELAALVLESYDRAYSNMVRVQQLAELEEVIEYCTLQTGN---------------
GK008_Glam       RLRIDPDLIGLSAESYTRAYNLCILLQTITELQNIISYKLALNGLKLDAPSTLIKEGGNP


FRAP_Hsap        -------------------PERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHED
FRAP_Mmus        -------------------PERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHED
B0261.2_Cele     --------------------ERRPRIALLWSRRLQGCRRNVEQWQRLIMLRGLVLSPQEM
TOR1_Scer        ------------------NSEKKLHYQNLWTKRLLGCQKNVDLWQRVLRVRSLVIKPKQD
TOR2_Scer        ------------------NSDKRLTMRETWNTRLLGCQKNIDVWQRILRVRSLVIKPKED
Tor_Ddis         ------------------SPERRNMIKNTWKTRLRGCQHNVDIWQSILAVHSLVISPHEE
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         --------------------ERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHED
CC1G_00894_Ccin  --------------------DQPERQAT-MRKTLQGCQPDVEVWQRILQVRTLVSSPEQD
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ---------------P-ASEARASLIRRMWRDRIRGAKRNVEVWQRLLSVRTLVLPPTED
GK008_Glam       YENIFETTLISFNPPPGFADTEKERLRLMWSRKISMIRWDCESWEALLRVRRLIIFPIED


FRAP_Hsap        MRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSR--------------------------
FRAP_Mmus        MRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSR--------------------------
B0261.2_Cele     HPLRVKFSSMCRKQGKNSMSRAVLRELLSLPANS--------------------------
TOR1_Scer        LQIWIKFANLCRKSGRMRLANKALNMLLEGGND------------------------P--
TOR2_Scer        AQVRIKFANLCRKSGRMALAKKVLNTLLEETDD------------------------P--
Tor_Ddis         LDMWLKFVGLCRKGSRLGLAQKTLTMLMGKDPST-----------------------T--
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         IHTWLKYASLCRKSGSLHLSHKTLVMLLGTDPKL--------------------------
CC1G_00894_Ccin  PVMWIKFANLCRKNDRMMLAEKTINSLLTPERRM-----------------------L--
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        AETWLKFASLCYKSGRYD-------------PEQ-----------------------S--
GK008_Glam       QEVWIRFSVLCLQSGRVQLARKTLETFINSSSVHHIKVSKSRGLYTLLGLTSFGTPRRYL


FRAP_Hsap        ------------------------------------------------------------
FRAP_Mmus        ------------------------------------------------------------
B0261.2_Cele     ------------------------------------------------------------
TOR1_Scer        ------------------------------------------------------------
TOR2_Scer        ------------------------------------------------------------
Tor_Ddis         ------------------------------------------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         ------------------------------------------------------------
CC1G_00894_Ccin  ------------------------------------------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------------------------------------------------------
GK008_Glam       KHGSGDVSTGGSVTPIGSALGAEMGVVQDLSAVGSSLAKYLLKDGVVKDAFTAQQHVALP


FRAP_Hsap        ---------------------------------------------------------QLD
FRAP_Mmus        ---------------------------------------------------------QLD
B0261.2_Cele     --------------------------------------------------------DLVR
TOR1_Scer        --------------------------------------------------------S--L
TOR2_Scer        --------------------------------------------------------D--H
Tor_Ddis         --------------------------------------------------------SQFG
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         --------------------------------------------------------N-PN
CC1G_00894_Ccin  --------------------------------------------------------DHHH
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ----------------------------------------------------------DP
GK008_Glam       TSDVLSIASHSVAKPTLQMIANASTHQGQSIEKETPLSIVGQQCDDAKRNAQRDLFNALI


FRAP_Hsap        HPLPTVHPQVTYAYMKNMWKSAR---KIDAFQHMQHFVQ--TMQQQAQ--------HAI-
FRAP_Mmus        HPLPTAHPQVTYAYMKNMWKSAR---KIDAFQHMQHFVQ--TMQQQAQ--------HAI-
B0261.2_Cele     AKAPFDKPLLVLALAKQLYQDDH---KDEAIRALEDLAN--HWNKRINPIPKATGR----
TOR1_Scer        PNTFKAPPPVVYAQLKYIWATGA---YKEALNHLIGFTS--RLAHDLGLDPNNMIAQSVK
TOR2_Scer        PNTAKASPPVVYAQLKYLWATGL---QDEALKQLINFTS--RMAHDLGLDPNNMIAQSVP
Tor_Ddis         SVLPNTHPRITFAYIKQLWSAGA---KQPAFEKLRTFVQ--ALRDT--------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         QPLPCNQPQVTYAYTKYMAANNQ---LQEAYEQLTHFVS--TYSQELSCLPPE-------
CC1G_00894_Ccin  HHNTKAPPNVVYAQLKYMWANGE---KEETLNHLRLFTA--SLAKDIQQETNEQGHR---
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        PPGYVVNPPVMLAYLKYLWSFGEESKRQTAYRRLQYLAL--DLANGQAS----MYCT---
GK008_Glam       PPLNHVYPHVLYAYCKHLWVSSN----ENVLEKLVAFTHLIRLCNDVSI-----------


FRAP_Hsap        --ATEDQQHKQELHKLMARCFLKLGEWQLNLQG-I-------------------------
FRAP_Mmus        --ATEDQQHKQELHKLMARCFLKLGEWQLNLQG-I-------------------------
B0261.2_Cele     ---ELIPPSTKEPARICAKVLLKLGEWTELKSKTSNNMQVGELSFVRQQVSPQYRTKESR
TOR1_Scer        LSSASTAPYVEEYTKLLARCFLKQGEWRIATQPNW-------------------------
TOR2_Scer        QQSKRVPRHVEDYTKLLARCFLKQGEWRVCLQPKW-------------------------
Tor_Ddis         -----------DDLPLQGRAYLKLGEWQLALGDTL-------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         -------ALKQQDQRLMARCYLRMATWQNKLQDSI-------------------------
CC1G_00894_Ccin  --PNVSKSKLAELTKLLARCYFKQGEWQMELKDDW-------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        --PQGA--SGS-------------------------------------------------
GK008_Glam       ---------QKTEPKLVCRMLIRLGAWYSDLLTPL-------------------------


FRAP_Hsap        NES--TIP----------------------------------------------------
FRAP_Mmus        NES--TIP----------------------------------------------------
B0261.2_Cele     TPETIAFE----------------------------------------------------
TOR1_Scer        RNT--NPD----------------------------------------------------
TOR2_Scer        RLS--NPD----------------------------------------------------
Tor_Ddis         SEA--SIP----------------------------------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         RPD--AIQ----------------------------------------------------
CC1G_00894_Ccin  DAR--NVE----------------------------------------------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------------------------------------------------------
GK008_Glam       DHK--SCSMIGTISPSEGYVNIPVQDTVTSCSAIWNSIVNNCDADASVCSTTYEATEHSA


FRAP_Hsap        --------------------------------------------------KVLQYYSAAT
FRAP_Mmus        --------------------------------------------------KVLQYYSAAT
B0261.2_Cele     --------------------------------------------------NTINYYQQAT
TOR1_Scer        --------------------------------------------------AILGSYLLAT
TOR2_Scer        --------------------------------------------------SILGSYLLAT
Tor_Ddis         --------------------------------------------------HIISSFKAAT
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         --------------------------------------------------GALECFEKAT
CC1G_00894_Ccin  --------------------------------------------------DILHSYYYAT
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------------------------------------------------SGVSPV
GK008_Glam       ERLELSSASTLDKAVAKLVDNILLAYDELSNVSLEECNQYNTVGMSRIGLIALEWFQVAA


FRAP_Hsap        EHDRSWYKAWHAWAVMNFEAVLHYKHQNQ-ARDEKKKLRHASGANITNATTAATTAATAT
FRAP_Mmus        EHDRSWYKAWHAWAVMNFEAVLHYKHQNQ-ARDEKKKLRHASGANITNATTAATTAASAA
B0261.2_Cele     QYDPGWHKVWHKLASTHFYAVCRERPHPTTVISPPQQPQQPKKMHIPPVTRATSPPPPAQ
TOR1_Scer        HFDKNWYKAWHNWALANFEVISMVQEETK-LNGGKNDDDDDTAVNNDN----------VR
TOR2_Scer        HFDNTWYKAWHNWALANFEVISMLTSVSK----KKQEGSDASSVTDIN-----------E
Tor_Ddis         ECDPNWYKAWHSWALINFEVVSHYEQNGG-T-----------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         SYDPNWYKAWHLWAYMNFKVVQAQKSA----LDKQQPPGASMGMTM--------------
CC1G_00894_Ccin  HYDPGWYKAWHTWALANFEVISHIDTLAE--NRATDIPGDSLASHV--------------
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        PLIAPWGKAWHRWALFNTAALSHYSMKG----DS--------------------------
GK008_Glam       DRDETSNHIWKCISHTTYAIVNSFAAYID-KL--NDRPGVDGG------LQIVTRRSSVD


FRAP_Hsap        TTASTE--GSNSESEAESTENSPTPS----P-------------------------L--Q
FRAP_Mmus        AATSTE--GSNSESEAESNENSPTPS----P-------------------------L--Q
B0261.2_Cele     KSPQPAPFHSITEPL-SVIIDYPVPPPLGSLVGLPPMPAYLSSNSSLPPQHHHVSPLSND
TOR1_Scer        IDGSIL--GSG-------------------S-------------------------L--T
TOR2_Scer        FDNGMI--GVN-------------------T-------------------------F--D
Tor_Ddis         ------------------------------------------------------------
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         --------GS--------------------------------------------------
CC1G_00894_Ccin  --------VQ---------------------------------------------A----
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        ------------------------------------------------------------
GK008_Glam       ATSDAV--GSTSEALSQSVQDSDRPLVC--P---EH--------------------L--G


FRAP_Hsap        --KKVTEDLSKTLLMYTVPAVQGFFRSISLSRG-----NNLQDTLRVLTLWFDYGHWP--
FRAP_Mmus        --KKVTEDLSKTLLLYTVPAVQGFFRSISLSRG-----NNLQDTLRVLTLWFDYGHWP--
B0261.2_Cele     --SPSNSAENKLYLKHAAHAVRCFAKALMCSP-----GSRLEDTLRLMQLWFDHGDDKDQ
TOR1_Scer        --INGNRYPLELIQRHVVPAIKGFFHSISLLET-----SCLQDTLRLLTLLFNFGGIK--
TOR2_Scer        --AKEVHYSSNLIHRHVIPAIKGFFHSISLSES-----SSLQDALRLLTLWFTFGGIP--
Tor_Ddis         ---------PEQIGAHLLPAVHSFFKSISLGPD-----RSLQDTLRLLTLWFKHGAQK--
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         ----GLDSDLMIIQRYAVPAVQGFFRSISLIK-----GNSLQDTLRLLTLWFDYGNHA--
CC1G_00894_Ccin  ---VTGKPPFVAVLDAMLILGKGFFRSISLRN-----QDALQDTLRLLTLWFKYGHHD--
AqueK046_Aque    -------------------------------------------TNRLLTLWFDYGHIS--
FRAP_Smoe        ----------VKAAHHVVSAVSGYFKSIANASTNKGGDDSLQDILRLLTLWFNHGASD--
GK008_Glam       FVQNRQVLLEKAKLEYLVESIIAHFKCIETGRS----IEALPTTLRLMTLWFRYGSYD--


FRAP_Hsap        DVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPL-VGRLIHQLLTDIGRYHPQALIYPL
FRAP_Mmus        DVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPL-VGRLIHQLLTDIGRYHPQALIYPL
B0261.2_Cele     DVYFALTETIFDLPVTTWLEAIPQLMARLDCPDDQKSVQLVLRVLCEIARHRPQAVIYAL
TOR1_Scer        EVSQAMYEGFNLMKIENWLEVLPQLISRIHQPDPT-VSNSLLSLLSDLGKAHPQALVYPL
TOR2_Scer        EATQAMHEGFNLIQIGTWLEVLPQLISRIHQPNQI-VSRSLLSLLSDLGKAHPQALVYPL
Tor_Ddis         EVEAALMQGFNTISIDTWLHVIPQIIARIHAPVLP-VRRLLHELIDTIGKEHPQALVYPL
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         EVYEALLSGMKLIEINTWLQVIPQLIARIDTHRQL-VGQLIHQLLMDIGKNHPQALVYPL
CC1G_00894_Ccin  EVSHSMANGFSTVEVDTWLEVIPQIIARIQTPHAN-IRRNINNLLTDVGKHHPQALIYPL
AqueK046_Aque    EVHEALEEGIKTVDIENWLQVIPQLIARIDSPRRL-VSKLIHELLTDVGRHHPQALIYPL
FRAP_Smoe        EVYAALQDGFKHVIIDTWLVVLPQIIARIHSHIPA-VRELIQQLLVRIGQIHPQALMYPL
GK008_Glam       EVETEIINGLAAVPINIWLDVIPQLIARLHSPQHK-IRLLVHQLLVLIGTEHPQALIYPL


FRAP_Hsap        TVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASR
FRAP_Mmus        TVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASR
B0261.2_Cele     TVASRSKDVHRSKNAGTVLEKMMEYHSKLVREASLVTEELVRCAILWHEQWHDALDDASR
TOR1_Scer        TVAIKSESVSRQKAALSIIEKIRIHSPVLVNQAELVSHELIRVAVLWHELWYEGLEDASR
TOR2_Scer        MVAIKSESLSRQKAALSIIEKMRIHSPVLVDQAELVSHELIRMAVLWHEQWYEGLDDASR
Tor_Ddis         TVATKSHSPARLAAAKSLMDKMRKHSATLVDQALPVSQELVRTAILWLEMWYEGLEEASR
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         TVASKSASLARRNAAFKILDSMRKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASR
CC1G_00894_Ccin  TVASKSSSSARRTAAIQIMERMKDHSSTIVTQALLVSKELIRVAILWHEMWHEGLEEASR
AqueK046_Aque    TVAAKSQSTVRRDAADMILSNMREHSSDLVQQAVMVSEELIRVAILWHEQWHETLEDASR
FRAP_Smoe        LVACKSISSSRKTAALTVVDRVRQHHVALVEQAQLVSQELIRVAILWHEMWYEALEEASR
GK008_Glam       VVASKSTILNRRVESLSIVDQIRRTNEAMILESLNINKELQRVAILWPEIAYDLITQAST


FRAP_Hsap        LYFG----E-RNVKGMFEVLEPLHAMME-RG-PQTLKETSFNQAYGRDLMEAQEWCRKYM
FRAP_Mmus        LYFG----E-RNVKGMFEVLEPLHAMME-RG-PQTLKETSFNQAYGRDLMEAQEWCRKYM
B0261.2_Cele     VYFHRRLQD-NNVQAMFDALRNMNDLMQ-KGAPTTMKEHSFQQTYSSDLKEAGRYVQAFE
TOR1_Scer        QFFV----E-HNIEKMFSTLEPLHKHLG-NE-PQTLSEVSFQKSFGRDLNDAYEWLNNYK
TOR2_Scer        QFFG----E-HNTEKMFAALEPLYEMLK-RG-PETLREISFQNSFGRDLNDAYEWLMNYK
Tor_Ddis         QYFG----D-HNPEAMLATLAPLHQILE-KG-PETTSETSFLQAFGRDLQEALEWSKKYE
FRAP_Spur        ----------------------------------------FH------------------
TOR_Dmel         LYFG----D-RNVKGMFEILEPLHAMLE-RG-PQTLKETSFSQAYGRELTEAYEWSQRYK
CC1G_00894_Ccin  LYFN----D-KNPEGMIMALEPLHKLLE-KG-PTTARETSFAQVFGRELAEAREACKRYQ
AqueK046_Aque    MYFG----E-HNVQGMFKVLDPLHQKLD-KG-PETLKEISFNHVS---------------
FRAP_Smoe        LYFG----E-HNKEGMLNVLEPLHRKLEEEG-AVTLKEIAF--AYGRELQEAHEWCMEYR
GK008_Glam       AFCE----EPRDLVKFFNYACQLQLLAS-RT-PETQSESVFIQMFSSQLQAAWDSCRQFP
                                                         *

FRAP_Hsap        KSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDP-N-
FRAP_Mmus        KSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDP-N-
B0261.2_Cele     SSGNVKDLNQAWEIYCSVFKKLRDQLATLNSLDLVYVSPNLVSAKDLELVVPGTYDP-S-
TOR1_Scer        KSKDINNLNQAWDIYYNVFRKITRQIPQLQTLDLQHVSPQLLATHDLELAVPGTYFP-G-
TOR2_Scer        KSKDVSNLNQAWDIYYNVFRKIGKQLPQLQTLELQHVSPKLLSAHDLELAVPGTRASGG-
Tor_Ddis         KTRKEGDLNQAWDLYYQVFRRIYKQLPQMSSLELQYVSPKLLNSNNMELAVPGTYKA-S-
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         TSAVVMDLDRAWDIYYHVFQKISRQLPQLTSLELPYVSPKLMTCKDLELAVPGSYNP-G-
CC1G_00894_Ccin  IYGDPTELDKAWDIYYGVFKKVEKQLPSLTTLDLQYVSPSLLKARHLDLAVPGTYQS-G-
AqueK046_Aque    --------------------------------------LF--------------------
FRAP_Smoe        RTGNEAELTQAWDLYYHVFKRINKQLPSVTTLELQYVSPALLNARNLELAVPGTYRP-GP
GK008_Glam       VTNDLVCLNIVMKHYKEIYDRIHSELPFLNTIDLLQTSPLLYNISNTNLCVPGSYHP-A-


FRAP_Hsap        -QPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVN
FRAP_Mmus        -QPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVN
B0261.2_Cele     -APIVSIQSFSSKMNVITSKQRPRKMVIRGSNGLDYQFLLKGHEDPRQDERVMQLFGLVN
TOR1_Scer        -KPTIRIAKFEPLFSVISSKQRPRKFSIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVN
TOR2_Scer        -KPIVKISKFEPVFSVISSKQRPRKFCIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVN
Tor_Ddis         -ENVIRIQSFSQALSVIPSKQRPRKLTIIGSDGLEYTFLLKGHEDLRQDERVMQLFSLVN
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         -QELIRISIIKTNLQVITSKQRPRKLCIRGSNGKDYMYLLKGHEDLRQDERVMQLFSLVN
CC1G_00894_Ccin  -RPVITIASFATKLTVIASKQRPRRLSLKGSDGRDYQYVLKGHEDLRQDERVMQLFSLVN
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        EANVVTIQSFDPQLIVMPSKQRPRKCTIKGSDGQDYTFLLKGHEDLRQDERVMQLFGLVN
GK008_Glam       -RAITTIVKFYQKVFVIRSKQRPRKVGLVASDGEYYAFLLKGHEDLRQDERVMQLFTLIN


FRAP_Hsap        TLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKK-KILLNIEH
FRAP_Mmus        TLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKK-KILLNIEH
B0261.2_Cele     TLLANNSETCRRNLTIQRYSIVALSKDSGLIGWVPNCDTLHTLVKEYREKKAKIPLSIEH
TOR1_Scer        TLLKNDSECFKRHLDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHRDAK-KIPLNIEH
TOR2_Scer        TLLQNDAECFRRHLDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHREAK-KIPLNIEH
Tor_Ddis         NLLSANHETAKSHLSIRRFSVIPLSPNSGLIGWVPHSDTLHTLIKDFRDSN-KILLSIEH
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         TLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGWVPHCDTLHTLIRDYRDKK-KVPLNQEH
CC1G_00894_Ccin  TLLSVDTNSFKRRLHIQRYPVIPLAPNAGLLGWVQDSDTLHVLIRDYRESR-KVLLNIEY
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        TLLTNARHTAEKDLSIQRYDVVPLSPNSGLIGWVPNCDTLHHLIREYRDAR-KVPVNAEH
GK008_Glam       NLLMNDSYCSRRGLMVMKYPITPLSQNSGLLYWVPGCDTIISLIKEFRQLK-RIHLETEM


FRAP_Hsap        RIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLA
FRAP_Mmus        RIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLA
B0261.2_Cele     KTLQKLSLETEHLTLMQKLQLFESALSVTQGEDLRHVLWLKSPSSEVWFDRRTNYTRSVA
TOR1_Scer        WVMLQMAPDYENLTLLQKIEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLA
TOR2_Scer        WVMLQMAPDYDNLTLLQKVEVFTYALNNTEGQDLYKVLWLKSRSSETWLERRTTYTRSLA
Tor_Ddis         RLMLQMCSDYDNLTLLQKVEVFQYALENSNGLDLHKVLWLKSRNSEVWLDRRTNYTRSLA
FRAP_Spur        ------------------------------------------------------------
TOR_Dmel         RTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDLAKLLWLKSPSSELWFERRNNYTRSLA
CC1G_00894_Ccin  RLMLQMAPDYENLMLLQKVEVFEYALENTTGQDLYRVLWLKSTNSEHWLERRATYTRSLA
AqueK046_Aque    ------------------------------------------------------------
FRAP_Smoe        RAMVSFAPDLDHLTLIAKVEVFQHALEATDGDDLAKVFWLKSKTSEVWLERRTNYTRSLA
GK008_Glam       QQIKYRAPAFMNMALHYKVDAFKYMLTTSDAIDLCRSLWNKASSAEDWLLKRMNYTRSIA


FRAP_Hsap        VMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTN
FRAP_Mmus        VMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTN
B0261.2_Cele     CMSMVGYILGLGDRHPSNLMLDRLTGKVVHIDFGDCFEVAMLREKFPERVPFRLTRMLIN
TOR1_Scer        VMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLTY
TOR2_Scer        VMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFE