Protein (view, download) , Domain (view, download)
AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   MAAETN------------------------------------------------------
AqueK140_Aque   M-----------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   M-----------------------------------------------------------
AqueK543_Aque   HEEGYK------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   MIKFT-------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   MYCICV------------------------------------------------------
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   MAAKAL------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   MTGLN-------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   MLSAMF------------------------------------------------------
AqueK560_Aque   MGVTSS------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ME----------------------------------------------------------
AqueK563_Aque   MATFSG------------------------------------------------------
AqueK564_Aque   MHNND-------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   TRVLQERERELQEERREKEQVRNRLQQQLQGRERQLQQAQQQGQERERQARKQVQDLQRQ
AqueK568_Aque   MAAKVP------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   MAVAQS------------------------------------------------------
AqueK573_Aque   LEKKLE------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   ------------------------------------------------------------
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   LQQAQHQFQEHPINVEDYEKLKLKVADMEEQYLKEKQIIIDDVQNLKTDISEKDKVIAKL
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   -----------------------------------------P------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   -------------------------------------------S----------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   -----------------------------------------L-VFITLSAWLSNPGGSVQ
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   -----------------------------------------AW-----------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   -----------------------------------------SGS----------------
AqueK560_Aque   -----------------------------------------FTK----------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   -----------------------------------------S------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   TSQVEEQSQNEKQIITDLKEKDLYIAKLVKERSKETSSIGLQF-----------------
AqueK568_Aque   -----------------------------------------E------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   -----------------------------------------LP-----------------
AqueK573_Aque   -----------------------------------------E------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   WPKKRRSHSSVLINTGSGPHLLVVGGYNRTSDIWIFDINNKSWEKLFNLSDIVIERYSHS
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   LSS---------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   L----------SVWSVTPTTNWIIVFGGSTSYTDPAVIELRATTEGNPMILTELMPTSLR
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   LR----------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   LSRSSDSIDFLL------------------------------------------------
AqueK560_Aque   M-----------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   NY----------------------------------------------------------
AqueK568_Aque   D-----------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   VGL---------------------------------------------------------
AqueK573_Aque   C-----------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   KELEIGGVAYPAILSISLDVACALNYLHLFKPHPILHRDVSSANVLLQPMIGVWRAKVSD
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   YGSANLQHSIIRSVNPGGPLYAAPEAANPKEHSPSMDVFSYGVLLLEMITRRIPLPEERV
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   GLIDDYQPVERSGHSTVRYVGSENVNRRRGDAEAARYCLPTLRTASKNMRAHKPKAVLGL
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   NLKGVSLYDERSKSITRVPVDKVTYVTLDPEDQCYFGVIIQTKESHTGFRLYCFKAERPI
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   AVTFVNSSRELFDLIMKLRQAKKKMKEEREEADKAPQDPDTSNLPAENAPPPSYTSVSKA
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   PDRPPPPMPKQAPAMPPRPQEADIFSFGNEPPPPTFDDVYDVSSGALTSLYGNQPQAPPT
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   FAPPPQPNPFGMAGQPPPPNYPPPPVQEPSITMDLMDAIRNPQQSTTTAYLIGMGMRMPG
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   LGMGPPAGLPADLLLDSNFSQPLLPTNTGGAGPPGGGQPPQGAGGKIDAFSDLVSIARDK
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------------------------------------------
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   ------------------------------------------------------------
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   TTSKPEPAPPTIFQSPPTNTETSPPLPYRPPDLDFTDAPPTTSGPAPSGFDNTFGALPPA
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------------------------------------------
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   ------------------------------------------------------------
AqueK568_Aque   ------------------------------------------------------------
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ------------------------------------------------------------
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   ------------------------NYYQPVERHGHTTVQVGDYLYMWGGNQPGLPEVHDS
AqueK140_Aque   ------------------------------------------------------------
AqueK141_Aque   -------------------------DYQPVKRSGHSTVRVGDYLYMWGGNQPDLPEVHNN
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   --------------------YNTHHPYSPNLR--HSPDPPADY-----------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   PGTGGWFWRXKASPPNKMAAKA--PDYQPGKRREHSTVRVGDYLYMWGGGQPDLPAVHNN
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   --------------------KSKAPDYQPVERNSHST-----------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   ------------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------KLEGRVEDHKPVERGYHSTV----------------------
AqueK560_Aque   ------------------AAKGPGKDYQPVKRMYHSTVRVGDYLYMWGGKQPNLPEVHNN
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   ------------------------QG-------LPLLLD--------------------K
AqueK564_Aque   ------------------------------------------------------------
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   ------------------------------------------------------------
AqueK567_Aque   --------------------LIPSMDYQPVERNSHSTVRVGDYLYMWGGTQPDPPRVHNN
AqueK568_Aque   ----------------------YQSNYQPVERREHSTVRVGDYLYMWGGVQPDLPEVHNN
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ------------------------------------------------------------
AqueK572_Aque   ---------------------SLFSDYQLVERSGHSTLKVGDYLYMWGGIQPDLPTAHNN
AqueK573_Aque   ------------------------QN-------ISSTLS--------------------V


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   EEKKSICSVVEV----------CNL------------------------ATGMWVQKPTT
AqueK140_Aque   ------CSVMEV----------CHL------------------------RTGRWEQKPTT
AqueK141_Aque   EEKKSMCSVMEV----------CHL------------------------LTGRWEQKPTT
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   ------------------------------------------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   -HQI--------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   EKKKSMCSVMEV----------CHL------------------------RTGRWEQKPTT
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   ------------------------------------------------------------
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   -----DRR----------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   -FPW--------------------------------------------------------
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   EKKKSMCSVMEV----------YHL------------------------VTGRWEQKPT-
AqueK561_Aque   -----MGFIDTA------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   SHLNEVFLLLRK----------CQF--------------------------------PDR
AqueK564_Aque   -KKKALSSLMEV----------YHL------------------------PTSRWEQKPTT
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   -----MCTVMEV----------CHL------------------------RTGRWEQKPTT
AqueK567_Aque   EKKKSMYSVMEV----------CHL------------------------RTGRWEQKPTT
AqueK568_Aque   EKKKSMCSVMEV----------CHL------------------------RTSRWEQKPTT
AqueK569_Aque   -----MQYLYN-HMKEFS-----------------------FAYRMILVR----------
AqueK570_Aque   -----MYLSLI-------------------------------------------------
AqueK571_Aque   -----MYRIKVTSLSDVTIDELKELQAQTTELKTKNVHQLLVHSDDLDWNTIAYEQFNSV
AqueK572_Aque   EKKKAMSTLIEV----------YHL------------------------PTGAWEQKATI
AqueK573_Aque   I-----------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   GTPPLGV----DGY-SAAVIRNEIYFFGGLCHHDKCYHNSLYSFNVDTLNWKELSPTTSH
AqueK140_Aque   GYPPLGV----VSY-AAAAIGREIFYFGGYCNHDDCYYNSLYSFNVDTFSWKELSPTTSH
AqueK141_Aque   GNPPLGV----SGY-AAAAIGRVIFYFAGWCNYVGCLHNSLYSFNVDTFNWKELSPTTSR
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   -----------RGG-NHQGYNRDNQY-------------------------------RGH
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   GNPPLGV----NGY-AAAAIGREIFYFGGYCNHGDCYHNSLY------------------
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   --------------------------------------RPLYGFNVDTFKWKELSPTTSH
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   -----GV-----------------------------------------------AVSDGN
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   RGFELGL----AL--------------------------GLSKNTLDTIKA---------
AqueK564_Aque   GNPPLGI----LGY-VSAAIGNEIFYFGGGCNHDSCYHNSLYSFNVDTFTWRELSPTTPH
AqueK565_Aque   ------------------------------------------------------------
AqueK566_Aque   GNPPLGV----VYY-AAAAIGREIFYFGGWCGHDTCSHNSLYSFNVDTFNWKELSPTTSH
AqueK567_Aque   GNPPLGV----RGY-AAATIGREIFYFGGY---RDSYHNSLCSFEVDTFNWKELSPTTSH
AqueK568_Aque   GNPPLGV----SSY-AAAAIGREIFYFGGHCGHGGCLHNSLYSFNVDTSNWKKLSPTTSR
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   LAPSLWLKEAIRLYGSSGAVWTAVSKFVGTRNSTQC------------------------
AqueK572_Aque   GIPPLGI----SGY-ASAVIGNEIFYYGGYCNHDDCYHNSLYSFNVDTLTWKLLSSTTPH
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   GGPMMKAQS--G--------------MIPLH-LNGEDYLAVIGGRRQ---SSVNTPLQPG
AqueK140_Aque   HGPMMKANC--D--------------MIAIK-KNGEDYLVVIGGFGP---SSNNTPPQPG
AqueK141_Aque   HGPMMKYIC--D--------------MTAIK-VNGEDYLVVIGGYQQ---SSNNVPEQPD
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   HDPPGYHGC--GDPSPDPHHQFTIGSMVRIDTVKGDPLYGVVKWIGP---V----PDYPG
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   ------------------------------------------------------------
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   HGPRMKHLC--D--------------MIAIK-VNSEDYLVVVGGYGS---TSNNTPKQPG
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   HFIIAEWNG--S--------------CVTIL-DNEGKKVKSIGGEGG---SSNNKFSCPC
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   NNPQDVNQCLIE--------------CLSKW-LERADDVSSKGGTTY---VSLSTAIRDI
AqueK564_Aque   HGPMIKAHC--S--------------MVAFQ-LNGKDYLAVIGGQGP---SSNNTPTQPN
AqueK565_Aque   --------------------------MIATK-VKNEDYLIVIGGSGP---SSNNTPKQPG
AqueK566_Aque   HGPMMKWLC--D--------------VIAIK-VNGEDYLVVIGGYGS---SSNNTPKQPG
AqueK567_Aque   HGPMMKNYC--G--------------MIAIK-VNGEDYLVVIGGYGS---TSNNSPKQPG
AqueK568_Aque   LGPKMKGYC--D--------------MIAMK-VNGEDYLVVIGGQGP---STNNTPKQPG
AqueK569_Aque   ----------------------------------SLQYSLTNGGDG--------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   ----------------------------------RERYRNVLAGQHLIRPWTENETKK-L
AqueK572_Aque   HGPRMKHHC--G--------------MVPIH-FDGESYLVLIGGYGP---AYNNTLKQPG
AqueK573_Aque   -----DKEC--S--------------LI-----DIELFCAVVKNFQI---KA--------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   AE-----------YI--D-C-------IYFRCNEI---------------------HLYK
AqueK140_Aque   AQ-----------YS--G--------GVHQRCNEI---------------------HFYK
AqueK141_Aque   AQ-----------YN--------------VRNNEI---------------------HLYK
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   TIAGVEMEKPLRDC-------------TDGTWRGI---------------------RFFT
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   ------------------------------------------------------------
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   AQ-----------YS--E-IEDIFSIETNQRCNEI---------------------HFYK
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   GV-----------AI-TP-D-KFILVSDKHRIQKISM------------------DGYLI
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   ------------------------------------------------------------
AqueK560_Aque   ------------------------------------------------------------
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   NE-----------IAVAENI-------EKEKCPEILAVHIFNKHLPLLSKSLSDPVNVAR
AqueK564_Aque   AQ-----------YN--S-K-GM-AP-GLKRTNEI---------------------HYYK
AqueK565_Aque   AQ-----------YS--S-E-GY----SWQRCNEI---------------------HFYK
AqueK566_Aque   SQ----------------------------------------------------------
AqueK567_Aque   AQ-----------YS--D-----------QRCNEI---------------------HFYK
AqueK568_Aque   AQ-----------YS--D-R-GL-FS-SNQLCNEI---------------------HFYK
AqueK569_Aque   ------------------------------------------------------------
AqueK570_Aque   ------------------------------------------------------------
AqueK571_Aque   MD----------------------------YCNE-------------------------K
AqueK572_Aque   AQ-----------YW--Q-K-NL-VAAGMQHTNEI---------------------YYYK
AqueK573_Aque   ------------------------------------------------------------


AqueK138_Aque   ------------------------------------------------------------
AqueK139_Aque   IS-------------SGEWISPTITGDRPPPISAFTLTSITNNSAILFGGYTADGTSDKL
AqueK140_Aque   LS-------------TGQWISPTVTGDRPPPIHDFTLTSIDNSSAIQFGGSTTNRLSNNV
AqueK141_Aque   LS-------------SGDWISPTVTGDRPPPIDEFTLTSINNSSAILFGGDTANGRSNNV
AqueK542_Aque   ------------------------------------------------------------
AqueK543_Aque   CPPGRGYFCPLNTLKQDTKYMDTTQSDAPPDFQ---------------------------
AqueK544_Aque   ------------------------------------------------------------
AqueK545_Aque   ------------------------------------------------------------
AqueK546_Aque   ------------------------------------------------------------
AqueK547_Aque   ------------------------------------------------------------
AqueK548_Aque   ------------------------------------------------------------
AqueK549_Aque   -------------------------------------------SAILFGGYTDNGASNNV
AqueK550_Aque   ------------------------------------------------------------
AqueK551_Aque   LS-------------TGQWISPTVTGDRPPPINSFTLTSINNSSAILFGGFTANGDSNNV
AqueK552_Aque   ------------------------------------------------------------
AqueK553_Aque   ------------------------------------------------------------
AqueK554_Aque   ------------------------------------------------------------
AqueK555_Aque   ------------------------------------------------------------
AqueK556_Aque   ------------------------------------------------------------
AqueK557_Aque   AS-------------VGEEGSELLQFNSPHGISIFPITGQV---------YIADANNHRI
AqueK558_Aque   ------------------------------------------------------------
AqueK559_Aque   -Q-------------IGEWESPVVTGNRPPPISGFTIESLSKNTALLFGGATSFGHNSCV
AqueK560_Aque   ---------------TGDWIPPTITGDRPPPLTAFTLTSINNSSAILFGGEAANGDSSNV
AqueK561_Aque   ------------------------------------------------------------
AqueK562_Aque   ------------------------------------------------------------
AqueK563_Aque   LL-------------YG---ERVITQEKLNSVEDDALTHISNKRQVLLTAVKDAIQADHV
AqueK564_Aque   LS-------------SGKWSSPNVTGDRPPPTSYFTLTSITNDCAILFGGATPNGSSNNT
AqueK565_Aque   LS-------------TGQWISPTVTGDRPPPINIFTLTSINNSSAILFGGDTANGESNNV
AqueK566_Aque   -Y-------------SGQWISPTVTGDRPPPINEFTLTSINNSSAILFGGDTANGYSNNV
AqueK567_Aque   LS-----------