Protein (view, download) , Domain (view, download)
AqueK142_Aque   MPLAM-------------------------------------------------------
AqueK143_Aque   MQ----------------------------------------------------------
AqueK144_Aque   M-----------------------------------------------------------
AqueK574_Aque   MSSKKE------------------------------------------------------
AqueK575_Aque   MLMK--------------------------------------------------------
AqueK576_Aque   MFI---------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   MADTTNSLGIGDLAEIL------DLLKKHGYSGV--------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   LTVPI--------------------------------------------------LNTLL
AqueK582_Aque   MTS---------------------------------------------------------
AqueK583_Aque   MYCQ--------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   MHCQS-------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   MYLEI-------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   MN----------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   MYCQS-------------------------------------------------------
AqueK592_Aque   MNTLDIK------R-------------RRG---AGYGVSEEKLSRKSRSSVLHSVI----
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   MLS---------------------------------------------------------
AqueK595_Aque   MIIICS------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   MSESQN------------------------------------------------------
AqueK598_Aque   M-----------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   MIEFRDL------SDHVTLLRAMAVARF-------FG----------------SRA----
AqueK601_Aque   MME---------------------------------------------------------
AqueK602_Aque   M-----------------------------------------------------------
AqueK603_Aque   MEGNYTF-----------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   MTLIQ-------------------------------------------------------
AqueK607_Aque   M-----------------------------------------------------------
AqueK608_Aque   YDRDD-------------------------------------------------------
AqueK609_Aque   MAS---------------------------------------------------------
AqueK610_Aque   MAASL-------------------------------------------------------
AqueK611_Aque   MAMAS-------------------------------------------------------
AqueK612_Aque   MQKEACE------G-------------K-----CP------------------YGC----
AqueK613_Aque   MYCQS-------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   MAWLF-------------------------------------------------------
AqueK616_Aque   MAFE--------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   MADVMEDIM-AWFG--------F-------------------------------KI----
AqueK619_Aque   MST---------------------------------------------------------
AqueK620_Aque   MIVK--------------------------------------------------------
AqueK621_Aque   MILEK-------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   ELLSLDKHGNKADIIARILTFLSKPVDNGIAGGGPTKKSKVDEDEEAGPETEKDNKGEKE
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   DNGDKDESKMETEDKDESKMETEEEKAPSGATGTDPVTNDQDDSKEDEKEKDEDNGGERK
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   WNNPSIIGQCIPPASHFIIEKINNTRAVLFGGVETDDDAKTTYTNNIYILEISINIVFWQ
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   CIRKPEAIDQWPVGRYAHAGAIIITGSDCPMLVISGGEDDNYDILDDCWIFNITQHSWIK
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   LDVPHSVSKRWAHSLSVFIMSPHCVWIITDGGYDKRQTLVTNPNIVMITELVTNSKGEWT
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ----------------DFYNLSLQLGL---------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   VGDTLDTNGMNNEEYKKKYQEQLQTGRRIELEEYQKPRKRDTADIERTVQALMKCLEEKE
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   RELRQSQEAVRRYQQQALTDDHWVINKDEVTSNSSRHERKSITGTPVIPEVAYRVISECI
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   SGIRRCGIDLHLLAEKLLEKKIINNRQKRKATDEHSGRTTDQRMDQLLDIIKDSVQQEGK
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ------------------------------------------------------------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ----------------------ASK-----------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------N-----------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   -------------------------LPRTL------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   VFEYILEILKDEDTILANKLYDDMI-----------------------------------
AqueK582_Aque   ------------------------T-----------------------------------
AqueK583_Aque   -----------------------IL-----------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ----------------------IAL-----------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ----------------------SKVHPTLC------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ----------------------LII-----------------------------------
AqueK592_Aque   --------------------IIYTV-----------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------L-----------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------Y-----------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   --------------------RGEDK-----------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ----------------------NQFGSPAVAAVFIVEMILALIANGVVLSITLYQRKSLK
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------E-----------------------------------
AqueK610_Aque   ----------------------LF------------------------------------
AqueK611_Aque   ------------------------K-----------------------------------
AqueK612_Aque   --------------------SLCDK-----------------------------------
AqueK613_Aque   ----------------------FII-----------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ----------------------GSK-----------------------------------
AqueK616_Aque   ------------------------T-----------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   --------------------ENQSR-----------------------------------
AqueK619_Aque   ------------------------I-----------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   --------------------------------DV--------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   ------------------------------------------------------------
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   --------------------------------HY--------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   QPSTIFFTSLILAHLVLILLNLPFIIVGLAAGKWIFTGSDEEETGTCYFALYIFWWMVLV
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------NQLN--------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------IA-------------K--------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   ------------------NQLK--------------------------------------
AqueK582_Aque   ------------------NQLK--------------------------------------
AqueK583_Aque   ------------------IDLK--------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------DKPN--------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------FIRL--------LEAN--------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------DQLK--------------------------------------
AqueK592_Aque   ------------------DQLN--------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------D-----------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------YRLK--------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------DQVN--------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   ISTTLAAISVDRFLFIVKPHLHNRFMKPWVALTLTIAIWILSAVYTTFYIFGLDFDLYQF
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------NRLN--------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------NQLN--------------------------------------
AqueK612_Aque   ------------------NKLN--------------------------------------
AqueK613_Aque   ------------------DQLN--------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------NQLN--------------------------------------
AqueK616_Aque   ------------------NQPS--------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------DQLN--------------------------------------
AqueK619_Aque   ------------------DQPN--------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   ------------------------------------------------------------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   ------------------------------------------------------------
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   ------------------------------------------------------------
AqueK582_Aque   ------------------------------------------------------------
AqueK583_Aque   ------------------------------------------------------------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   ------------------------------------------------------------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   ------------------------------------------------------------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   ------------------------------------------------------------
AqueK592_Aque   ------------------------------------------------------------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   ------------------------------------------------------------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   ------------------------------------------------------------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   ------------------------------------------------------------
AqueK603_Aque   NSSFCFLPSSSSRGFLGIFATIIILGIIVVTTLWTFCFTRRFFRDHAEKEVPVIHIYDGR
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   ------------------------------------------------------------
AqueK610_Aque   ------------------------------------------------------------
AqueK611_Aque   ------------------------------------------------------------
AqueK612_Aque   ------------------------------------------------------------
AqueK613_Aque   ------------------------------------------------------------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   ------------------------------------------------------------
AqueK616_Aque   ------------------------------------------------------------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   ------------------------------------------------------------
AqueK619_Aque   ------------------------------------------------------------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   ------------------------------------------------------------


AqueK142_Aque   --------------------ERAGHCTVSV----GDSLYVWGGA-QAGL-----------
AqueK143_Aque   ------------------------------------------------------------
AqueK144_Aque   ------------------------------------------------------------
AqueK574_Aque   ------------------------------------------------------------
AqueK575_Aque   ------------------------------------------------------------
AqueK576_Aque   ------------------------------------------------------------
AqueK577_Aque   ------------------------------------------------------------
AqueK578_Aque   --------------------SNSGDVSSCL----RESLKAWLEQ-ADNVASNGGPTYFTL
AqueK579_Aque   ------------------------------------------------------------
AqueK580_Aque   ------------------------------------------------------------
AqueK581_Aque   --------------------GRASHHTVSV----GDSLYVWAGK-QDGL-----------
AqueK582_Aque   --------------------GRAFHCTVSV----GDSLYVWGGA-QDGL-----------
AqueK583_Aque   --------------------KRAAHRTVSV----GDSLYVWAGD-QDDL-----------
AqueK584_Aque   ------------------------------------------------------------
AqueK585_Aque   --------------------ERMYHRTASV----GDSLYVWAGY-QAGL-----------
AqueK586_Aque   ------------------------------------------------------------
AqueK587_Aque   --------------------GLLLRCYTEN----IDTLERRAGITDEHL-----------
AqueK588_Aque   ------------------------------------------------------------
AqueK589_Aque   ------------------------------------------------------------
AqueK590_Aque   ------------------------------------------------------------
AqueK591_Aque   --------------------GRAAHCTVSV----SDSLYVWGGH-QDGL-----------
AqueK592_Aque   --------------------GRATHCAVSV----GDSLYVWGGD-QVDL-----------
AqueK593_Aque   ------------------------------------------------------------
AqueK594_Aque   ------------------------------------------------------------
AqueK595_Aque   ------------------------------------------------------------
AqueK596_Aque   ------------------------------------------------------------
AqueK597_Aque   --------------------ERSFHATLSV----GDSLYVWGGF-QKEL-----------
AqueK598_Aque   ------------------------------------------------------------
AqueK599_Aque   ------------------------------------------------------------
AqueK600_Aque   --------------------KIAGHRAVSV----GDSLYMWAGI-HAGL-----------
AqueK601_Aque   ------------------------------------------------------------
AqueK602_Aque   --------------------------------------YVWAGN-QGRL-----------
AqueK603_Aque   GENKELTALSNIHNSPILFMKYNSHYDVIVSADSTGMLEYWSGS-TYSF-----------
AqueK604_Aque   ------------------------------------------------------------
AqueK605_Aque   ------------------------------------------------------------
AqueK606_Aque   ------------------------------------------------------------
AqueK607_Aque   ------------------------------------------------------------
AqueK608_Aque   ------------------------------------------------------------
AqueK609_Aque   --------------------GRAAHCTVSV----GDSLYVWGGR-QDGL-----------
AqueK610_Aque   ---------------------------GFK----SDSLYVWGGH-QDGLP----------
AqueK611_Aque   --------------------GRADHRTVSV----GDSLYVWAGL-QGGS-----------
AqueK612_Aque   --------------------ERARHRTVSA------EMYVWAGT-QSDF-----------
AqueK613_Aque   --------------------KRAAHRTVSV----GDSLFVWAGR-QDGLT----------
AqueK614_Aque   ------------------------------------------------------------
AqueK615_Aque   --------------------GRAFHRTVSV----DDSLYVWAGKLEDGL-----------
AqueK616_Aque   --------------------RRTGHRTVLV----GDSLYLWAGN-QVGL-----------
AqueK617_Aque   ------------------------------------------------------------
AqueK618_Aque   --------------------ERGSHRTVSV----GDSLYAWAGK-QDGL-----------
AqueK619_Aque   --------------------GRAHHQTVSV----GNSLYVWAGY-QDGL-----------
AqueK620_Aque   ------------------------------------------------------------
AqueK621_Aque   --------------