Protein (view, download) , Domain (view, download)
MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       VTHQTLSNNQAPASNQMASNFLTNSGQFNNNSQTTSSSSVPMTYSSNYLKKKNQIDTSPH
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       TPKYSPRKCMNNINTNCNNNSSFVAQGQNTSNQTHFQIPQNQNINYTSTTPRSSEKYNAN
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       GVNSNFSGYVSNYNANCYKNGNLSPYNTSSKQYTQLINEQDSQTPQNNSSNISIANSSNQ
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       LYNSRNATSVHGNRASGSQKKSMNQFEFIDVENIPQTQTMDLIDKFLKNSSALQSNNIAA
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       ENSTPSERKKYKNDLSPFKYSTNKVLNTNQSNTSAQQGGNLSIIQQQLEIFKQTSFTPSR
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       KSQQNPSQTKSSNSNNQSLSKNSQNIGSQSQAQSYGQSQHHNSQGKYQPSITSSTSSNSK
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       VFHQTNTPQQFREPLKNVNNINLQQYGQLQLREDKVPLQNLSSNNLSYTNQRNYTPTNSS
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       SAAKKLQTQTPQQQYLHYQYSNTPQNNKNNQSMVKSVKNSSNLNQNIISNNTPMTASKNL
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       LFGSTNNSGNYQIQSSAQENAFANVISSTKNDLSQQGPVEQQFPLNIQSQSSNKFKQTQK
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       VGCENIQLNTNASNYSGEFGFTPINNQKSTSKVSTFNLDVSRDLSMMINNNFNGHNASNN
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       QIHNTSNNLFNLNFLDKDSSNIFNFHNDKDQSQFSYNYIEKDYSTINNNVSKELSTFQTP
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ------------------------------------------------------------
KP78a_Dmel       ------------------------------------------------------------
Par-1_Dmel       ------------------------------------------------------------
MarkmE3_Mmus     ------------------------------------------------------------
MarkmE2_Mmus     ------------------------------------------------------------
MarkmE1_Mmus     ------------------------------------------------------------
MarkmD4_Mmus     ------------------------------------------------------------
MarkmD3_Mmus     ------------------------------------------------------------
MarkmD2_Mmus     ------------------------------------------------------------
MarkmD1_Mmus     ------------------------------------------------------------
MarkmC2_Mmus     ------------------------------------------------------------
MarkmC1_Mmus     ------------------------------------------------------------
MarkmB3_Mmus     ------------------------------------------------------------
MarkmB2_Mmus     ------------------------------------------------------------
MarkmB1_Mmus     ------------------------------------------------------------
MarkmA9_Mmus     ------------------------------------------------------------
MarkmA8_Mmus     ------------------------------------------------------------
MarkmA7_Mmus     ------------------------------------------------------------
MarkmA6_Mmus     ------------------------------------------------------------
MarkmA5_Mmus     ------------------------------------------------------------
MarkmA4_Mmus     ------------------------------------------------------------
MarkmA3_Mmus     ------------------------------------------------------------
MarkmA2_Mmus     ------------------------------------------------------------
MarkmA12_Mmus    ------------------------------------------------------------
MarkmA11_Mmus    ------------------------------------------------------------
MarkmA10_Mmus    ------------------------------------------------------------
MarkmA1_Mmus     ------------------------------------------------------------
MARK4_Mmus       ------------------------------------------------------------
MARK3_Mmus       ------------------------------------------------------------
MARK2_Mmus       ------------------------------------------------------------
MARK1_Mmus       ------------------------------------------------------------
par-1_Cele       ------------------------------------------------------------
F23C8.8_Cele     ------------------------------------------------------------
YPL150W_Scer     ------------------------------------------------------------
MARK-A_Ddis      ------------------------------------------------------------
MARK-B_Ddis      ------------------------------------------------------------
MARK-C_Ddis      ------------------------------------------------------------
14487_Tthe       ------------------------------------------------------------
11331_Tthe       ------------------------------------------------------------
11795_Tthe       ------------------------------------------------------------
12692_Tthe       ------------------------------------------------------------
14385_Tthe       ------------------------------------------------------------
20667_Tthe       ------------------------------------------------------------
20819_Tthe       ------------------------------------------------------------
23838_Tthe       ------------------------------------------------------------
26669_Tthe       ------------------------------------------------------------
28996_Tthe       ------------------------------------------------------------
5439_Tthe        ------------------------------------------------------------
12851_Tthe       LKGGKQQLSYMLETCTNLDNITTNNLTICSTTNNNANNNNNTTYTSNYNNYNTQKTNTKL
MARK3_Spur       ------------------------------------------------------------
MARK4_Spur       ------------------------------------------------------------
CC1G_02900_Ccin  ------------------------------------------------------------
CC1G_15424_Ccin  ------------------------------------------------------------
AqueK063_Aque    ------------------------------------------------------------
AqueK064_Aque    ------------------------------------------------------------


MARK4_Hsap       ------------------------------------------------------------
MARK3_Hsap       ------------------------------------------------------------
MARK2_Hsap       ------------------------------------------------------------
MARK1_Hsap       ------------------------------------------------------------
KP78b_Dmel       ---------------------------------------------