Protein (view, download) , Domain (view, download)
MST2_Hsap        MEQPPA------------------------------------------------------
MST1_Hsap        METVQLR---------------------NP------------------------------
MST2_Mmus        MEQPPA------------------------------------------------------
MST1_Mmus        METVQLR---------------------NP------------------------------
F14H12.4_Cele    MFLSNFSTDVTPLLNFSKVNFINFSVLPMPPSTDSSRRNSEE------------------
CG11228_Dmel     MSEPEVTSVVD---------------MKSPNISS------SC------------------
DDB0216375_Ddis  MEESGQL-----------------------------------------------------
Krs1_Ddis        MSTLNVP-----------------------------------------------------
1462_Tthe        MNMNEIG-----------------------------------------------------
17909_Tthe       MDS---------------------------------------------------------
29596_Tthe       MQNRPSL-----------------------------------------------------
5838_Tthe        MATQQSQ-----------------------------------------------------
MST_Spur         ML----------------------------------------------------------
AqueK233_Aque    MESHQ-------------------------------------------------------
MST-1_Smoe       MASPMAP-----------------------PGSPDSQHNVEEEEEEDDRDDAAAGGAGDL
MST-2_Smoe       MASPMAP-----------------------PGSPDSQHNVEEEEEEDDRDDAAAGGAGDL
GK080_Glam       MNLA--------------------------------------------------------
                 *

MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ------------------------------------------------------------
17909_Tthe       ------------------------------------------------------------
29596_Tthe       ------------------------------------------------------------
5838_Tthe        ------------------------------------------------------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       YSTVVYKPDHHSSAYSAALHKSAKDLSALLDKSAAGGDLDGEDDIYSTVVYKGSAREDED
MST-2_Smoe       YSTVVYKPDHHSSAYSAALHKSAKDLSALLDKSAAGGDLDGEDDIYSTVVYKGSAREDED
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ------------------------------------------------------------
17909_Tthe       ------------------------------------------------------------
29596_Tthe       ------------------------------------------------------------
5838_Tthe        ------------------------------------------------------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       EESAVKRSDPVSGEFKASREEFSTVILRTGDSFVRRAPESSAFLRKKPSLPRSRDEVLAP
MST-2_Smoe       EESAVKRSDPVSGEFKASREEFSTVILRTGESFVRKTPESSAFLRKKPSLPRSRDEVLAP
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ---------PKSKLKKLSE--DSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAI
MST1_Hsap        ---------PRRQLKKLDE--DSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAI
MST2_Mmus        ---------SKSKLKKLSE--DSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAI
MST1_Mmus        ---------PRRQLKKLDE--DSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAI
F14H12.4_Cele    ---------GSSDGFKLDS--SALNKPPEEVFDIVGKLGEGSYGSVHKAIHRESGHVLAI
CG11228_Dmel     ---------SFFKLKKLSE--ESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAI
DDB0216375_Ddis  --------------SDFKL--PEGIKDPSLEFDLIECLGRGSFGSVYKATYKKTGNIVAV
Krs1_Ddis        -----------------KE--TMSRKDPEKFFTIVEKLGEGSYGSVYKAINISTGIVVAI
1462_Tthe        -----------------SDSIICTTENPEQIFSLVEILGQGSYGKVFKALNLQNNKYYAV
17909_Tthe       ----------------------FNKQDPEEIFDIICILGQGNYGKVFKALCKQDKKEYAI
29596_Tthe       -----------AQI-------ISMDDDPEEIFEILDLLGEGSYGQVYKALHKQTGELVAV
5838_Tthe        -----------LQVKKNNDVFADYKLNPQERYEKVYRIGQGAFGVVYQAIDKFTDKIVAI
MST_Spur         --------------KKLSE--DALTKEPEEVFDLLEKLGEGSYGSVFKAIHKESGQVLAI
AqueK233_Aque    -----------KKLLKLSE--ESLMKEPEDVFDLLEKIGEGAYGAVYKALHKESGQLLAI
MST-1_Smoe       PQDDERFAKRRGSSSPVHE--NVAREDPSLKYDLLNQLGKGSYGAVYKARDRRTSEFVAI
MST-2_Smoe       PQNDERFAKRRGSSSPVHE--NVAREDPSLKYDLLNQLGKGSYGAVYKARDRRTSEFVAI
GK080_Glam       ------------------D--LIEEGNPRECFELLSPIGSGSYGAVWQAFSVLTSEIVAV
                                            *   :  :  :* * :* * :*         *:

MST2_Hsap        KQVPV---ESDLQEIIKEISIMQQCDSPYVVKYYGSYF--KNTDLWIVMEYCGAGSVSDI
MST1_Hsap        KQVPV---ESDLQEIIKEISIMQQCDSPHVVKYYGSYF--KNTDLWIVMEYCGAGSVSDI
MST2_Mmus        KQVPV---ESDLQEIIKEISIMQQCDSPYVVKYYGSYF--KNTDLWIVMEYCGAGSVSDI
MST1_Mmus        KQVPV---ESDLQEIIKEISIMQQCDSPHVVKYYGSYF--KNTDLWIVMEYCGAGSVSDI
F14H12.4_Cele    KKVPV---DTDLQEIIKEISIMQQCKSKYVVKYYGSYF--KHSDLWIVMEYCGAGSISDI
CG11228_Dmel     KLVPV---ESDLHEIIKEISIMQQCDSPYVVRYYGSYF--KQYDLWICMEYCGAGSVSDI
DDB0216375_Ddis  KLVPI---NEDFQEILKEINIMKQCKSKYVVQYYGNYF--KDETCWIIMEYCAFGSVSDM
Krs1_Ddis        KKVSV---DNDLEDMEKEISFMKQCKSPYIVTYYASFR--KENEVWIVMEHCGAGSVCDA
1462_Tthe        KVVNTG--NGDFDNLKKEISILQDCQSDYIVHYYGSYL--YNEQLWIIMEYCDIGSVNDL
17909_Tthe       KVMLV---NEDIFQISKEISILQNCKNQNIVGYFGSFF--KDNAIWLVTEYCEGGSALDL
29596_Tthe       KMVPN---EGD-SALEKEIRMLKECQSEYVVKYYASYY--KDQHLWLIMEYCAAGSIIDL
5838_Tthe        KILKI---NSDLNSHLNEETTLSDMNSKYIVKLYDKYIDAKNKEIWLVIEFCNMGSLADV
MST_Spur         KQVPV---DTDLQEIIKEISIMQQCDSTYVVKYYGSYF--KNTDLWIVMEYCGAGSVSDI
AqueK233_Aque    KQVPV---DADLQDIIKEISIMQQCDSQYVVKYYGSYF--KNTDLWIVMEYCGAGSVSDI
MST-1_Smoe       KVISLTEGEEGYDEIRGEIEMLQQCNHPNVVRYLGSYQG--EEYLWIVMEYCGGGSVGDL
MST-2_Smoe       KVISLTEGEEGYDEIRGEIEMLQQCNHPNVVRYLGSYQG--EEYLWIVMEYCGGGSVGDL
GK080_Glam       KRIPLE---SDTSALILEIQLMKKLNHPNIVKYLGSFVDKVDDELWIILEFCSAGAISDL
                 * :       .      *   :.. .   :*    .:    .   *:  *.*  *:  *

MST2_Hsap        IRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQ
MST1_Hsap        IRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQ
MST2_Mmus        IRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQ
MST1_Mmus        IRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQ
F14H12.4_Cele    MRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQ
CG11228_Dmel     MRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQ
DDB0216375_Ddis  MNITNRVLNEEQIALVCYSTLKGLYYLHRNSKIHRDIKPGNILVSEEGECKLADFGVSGQ
Krs1_Ddis        MKITDKTLSEDQIAVVSRDVLQGLAYLHSVRKIHRDIKAGNILMNHKGESKLADFGVSGQ
1462_Tthe        MKATQRTLSEVQIACILKGVLLGLKYLHNSKKIHRDIKAGNILINKDGACKLADFGVSAQ
17909_Tthe       IKIIQRTFNEQEISAILYQALLGLQYLHDNKKIHRDIKAGNILLNEKGEAKLADFGVSAE
29596_Tthe       VKITRIQLNEQQIASILQSTLKGLQYLHSNKIIHRDIKAGNILLDQRGNAKLADFGVSFQ
5838_Tthe        INITGQTFFEAEIACILDNVLQGLDYLHKNHRMHRDLKSANILLNNEGEAKLSDFGVASC
MST_Spur         MRRRNKTLNEAEIATILYSTLKGLEYLHFMRKIHRDIKAGNILLNNEGNAKLADFGVAGQ
AqueK233_Aque    MRIIERPLNEKEISVIVQYALKGLEYLHFKRKIHRDIKAGNILLNLDGHAKLADFGVAGQ
MST-1_Smoe       MSITDEPLEEVQIAYICREALKGLAYLHAIFKVHRDIKGGNILLTEQGEVKLGDFGVAAQ
MST-2_Smoe       MSITDEPLEEVQIAYICREALKGLAYLHAIFKVHRDIKGGNILLTEQGEVKLGDFGVAAQ
GK080_Glam       MRGCHKTLTEEQCSYTLASTLLGLRYLHKQHVIHRDIKANNLLISEDASVRIADFGVSAE
                 :      : * : :     .* ** ***    :***:*  *:*:   .  ::.****:

MST2_Hsap        LTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAI
MST1_Hsap        LTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAI
MST2_Mmus        LTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAI
MST1_Mmus        LTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAI
F14H12.4_Cele    LTDTMAKRNTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAI
CG11228_Dmel     LTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAI
DDB0216375_Ddis  LSERTRKRNTVIGTPFFLAPEVIQEVGYDNKADIWALGISAIEMAEFHPPYHDLHPMRVL
Krs1_Ddis        LSDTMAKRQTVIGTPFWMAPEVIQEIGYDYKADIWSYGITCIEMAESKPPLFNVHPMRVI
1462_Tthe        LFNTMGYIESFIGTPYWMSPEVLTQNKYNKKTDIWSLGITAIEMAEGNPPFSNFQAVSAM
17909_Tthe       QTYTNAEKQTLMGTPYWMSPEVLGNSKYNNKTDIWSLGITAIELAEGEPPYSNIHPFRAM
29596_Tthe       QIHTQAKAESKIGTPCWMAPEVIMHLKYDSKADIWSLGITAIELAEGEPPYSDVKPSMVM
5838_Tthe        KSD----ADTFVGSPYWLSPEQLNKQKYTNKVDIWALGICIIEMAEGMPPYGDLRPTSAM
MST_Spur         LTDTMAKRNTVIGTPFWMAPEVIQEIGYDCKADIWSLGITALEMAEGKPPYAEIHPMRAI
AqueK233_Aque    LTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSMGITAIEMAEGRPPYAEVHPMRAI
MST-1_Smoe       LTRTMSKRNTFIGTPHWMAPEVIQESRYDGKVDVWALGVSAIEMAEGLPPRSNVHPMRVL
MST-2_Smoe       LTRTMSKRNTFIGTPHWMAPEVIQESRYDGKVDVWALGVSAIEMAEGLPPRSNVHPMRVL
GK080_Glam       MQNSFAQRNSTIGTPYWLSPQQIKGEPYGFKADVWALGITAIELTEGKPPHSELTSMRAM
                         :: :*:* :::*: :    *   .*:*: *:  :*::*  **  :. .  .:

MST2_Hsap        FMIP--TNPPPTFRK------PELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNA-
MST1_Hsap        FMIP--TNPPPTFRK------PELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSA-
MST2_Mmus        FMIP--TNPPPTFRK------PELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKNA-
MST1_Mmus        FMIP--TNPPPTFRK------PELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSA-
F14H12.4_Cele    FMIP--TKPPPTFKK------PEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKNA-
CG11228_Dmel     FMIP--QKPPPSFRE------PDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNA-
DDB0216375_Ddis  FMIP--TSTSPTLKE------PHKWSPEFSDFIALCLAKEQSQRPSAKDLLKHSFFEKKL
Krs1_Ddis        FMIPNPSRPPPKLTE------PEKWSPEFNDFLAKCLTRKPELRPSAEELLKHPFITKA-
1462_Tthe        ILII--KKPPQGLSD------PTKWSQEFNRFVSRCLTINPDIRPTSEELLLDPFIVNN-
17909_Tthe       FAIK--KNPPQGLSN------PTQWSQEFSDFVKKCLTLDSNLRPSAKDLLSHPFIKQA-
29596_Tthe       AKIQ--QKPPQGLKN------PSQWSQQFNDFVKQCLQQDPQKRPTAEQLLQHPFIKEN-
5838_Tthe        KMIK--QNPIVNFQD------PQQFSDELNNFLCHCLQINPEDRWTAEQLLNHDFFKIH-
MST_Spur         FMIP--TKPPPTFRD------PEKWSQDFIDFTSKCLIKSPEDRATATDLLQHPFVRDA-
AqueK233_Aque    FMIP--TKPPPTLKQ------ADNFSNEFSDFISRCLVKSPEERPSATSLLQHRFVKGN-
MST-1_Smoe       FMIS--REPAPMLED------KEKWSLVFHDFVAKCLTKEPRLRPTATALLQHKFIEKC-
MST-2_Smoe       FMIS--REPAPMLED------KEKWSLVFHDFVAKCLTKEPRLRPTATALLQHKFIEKC-
GK080_Glam       IVIP--RQPPMKLKGRTNPFTKQPHSDVFADFVDRCLQHAEEDRATVEELLQHEFITMH-
                   *     .   :            *  :  *   **      * :   *  . *.

MST2_Hsap        KP----VSI-LRDLITEAMEIKAKR-HEE-------------------------------
MST1_Hsap        KG----VSI-LRDLINEAMDVKLKR-QES-------------------------------
MST2_Mmus        KP----VSI-LRDLIAEAMEIKAKR-HEE-------------------------------
MST1_Mmus        KG----VSI-LRDLINEAMDVKLKR-QEA-------------------------------
F14H12.4_Cele    PG----CDI-MQLMIQDAQEKAILG-QAPM------------------------------
CG11228_Dmel     KH----RSI-LKPMLEETCAIREQQ-RANRSFGGV-------------------------
DDB0216375_Ddis  KG----SYV-MKSLSETAQMVIERCGGRE--EAVKAAAERKSKQSGVSVDFIHCESVDEP
Krs1_Ddis        KS----HSL-LVPLIDEQDIIINEK-GRE--VAL--------------------------
1462_Tthe        TTRVNPQHF-LMNLVSDNMESIRVF-RKN-LLEKQ-------------------------
17909_Tthe       INY--SQYI-LSELVIENQELIEQY-RQE-NFNRD-------------------------
29596_Tthe       SR---PKAI-LSELVSNSIDAIERY-RNN-YHDQS-------------------------
5838_Tthe        KEN--LEYE-RKSLYERRKNALQQY-KIA-NLKNE-------------------------
MST_Spur         KP----VSI-LNAIINEANCIRERE-KL--------------------------------
AqueK233_Aque    KS----IDI-VKELVQLAMAKLEE--E---------------------------------
MST-1_Smoe       KGS--A-TS-MLPRIERARALKELS-ART--FGPE-------------------------
MST-2_Smoe       KGS--A-TS-MLPRIERARALKELS-ART--FGPE-------------------------
GK080_Glam       CKI--E-NDRIVSKSTLPTLIAERY-KCS--L----------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     --------------------------L---------------------------------
DDB0216375_Ddis  DSSDEEDLLERNNKRLSTQIQQKKEQQ---------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        --------------------------KG---E----------------------------
17909_Tthe       --------------------------D---------------------------------
29596_Tthe       --------------------------QAQEGENLIYGNQDTVIHYTTNQNTQNNQYYQMN
5838_Tthe        ------------------------------ISNSSYSGSNSSINYSY-------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       --------------------------Q---------------------------------
MST-2_Smoe       --------------------------Q---------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        -----------------------TQQQ---GEK-KN------------------------
17909_Tthe       ------------------------------------------------------------
29596_Tthe       VDSSNFQSENQGPIQYHQ---------MVINDQQQQQ----------------------Q
5838_Tthe        --------------YRNQLLFNSQEQQLQIQNQNKSSSDSSQAEQNFQTFIEKNSFQKTF
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ---------------------------QQRELEE-E--E---------------------
MST1_Hsap        ---------------------------QQREVDQDD--E---------------------
MST2_Mmus        ---------------------------QQRELEE-E--E---------------------
MST1_Mmus        ---------------------------QQREVDQDD--E---------------------
F14H12.4_Cele    ------------AA---------------------SSGN---------------------
CG11228_Dmel     ------------AAS------------QAKSLATQENGM---------------------
DDB0216375_Ddis  ------------AQQ------------QQQQAQQQQ--QQQQQQQQQYQPPSPNNNNRTT
Krs1_Ddis        ------------GIE------------QRDEEEEDE--D---------------------
1462_Tthe        ---------KQQP-A------------QQQQQEQKK--E---------------------
17909_Tthe       ---------------------------EDDDEEEEE--D---------------------
29596_Tthe       QQQQLLQ--NQQQ-L------------QQQQQQQQQ--Q---------------------
5838_Tthe        IEKDSSSNDSQNN-F------------GQQNQKQQQ--Q---------------------
MST_Spur         -------------------------------KEDDD--D---------------------
AqueK233_Aque    --------------------------------EEEE--E---------------------
MST-1_Smoe       -------------ATRGQTVKMHESVAATVLVRPDK--E-KAD-----------------
MST-2_Smoe       -------------ATRGQTVKMHESVAATVLVRPDK--E-KAD-----------------
GK080_Glam       ---------------------------VDVVVDGDD--A-QGE-----------------
                                                    .

MST2_Hsap        -ENSDED---EL---------DS--HTMVKTSVE------SVGTMRATST--M-SEG---
MST1_Hsap        -ENSEED---EM---------DS--GTMVRAVGD------EMGTVRVAST--M-TDG---
MST2_Mmus        -ENSDED---EL---------DS--HTMVKTSSE------SVGTMRATST--M-SEG---
MST1_Mmus        -ENSEED---EM---------DS--GTMVRAAGD------EMGTVRVAST--M-SGG---
F14H12.4_Cele    ----------------------D--ATLLSE---------------GMST--M-IDG---
CG11228_Dmel     -QQHITDNAFME---------DP--GTLVPE---------------KFGEYQQ-SSA---
DDB0216375_Ddis  TKNNDIN---EL---------DSLLNNMMMSSSA------SASTSPSPSS--ISSNG---
Krs1_Ddis        -EDSEDS---DD---------NR--GTMVRAKPR------S-----------MQNSG---
1462_Tthe        -EK---K---QV---------DK--RLMTEASHD--------------------------
17909_Tthe       -QE-DED---EE---------DD-NYRNHRQKGERYGDEEEEKVVRAKNK--K-ENV---
29596_Tthe       -QQ-QQL---QQQQQIQFEAENK-QIAQVESQVQNQNK------IQQEQS--I-SNQKQN
5838_Tthe        -QQ-QQ------KQQNNN-DYIP-SY-------------------------------FQY
MST_Spur         -EGSDED---DV---------DS--GTMVRGRPPVMNED-DSGTIIISGS--A-GNT---
AqueK233_Aque    -EGDEDD---EF---------V---------------------------------TA---
MST-1_Smoe       IDNEDTD---VG---------DF--GTMV-------------------------------
MST-2_Smoe       IDNEDTD---VG---------DF--GTMV-------------------------------
GK080_Glam       -----TD---YD---------EC--GTIVMAPPE------QHLPNPNFGT--M-VYE---


MST2_Hsap        ------------------------------------------------------AQTMI-
MST1_Hsap        ------------------------------------------------------ANTMI-
MST2_Mmus        ------------------------------------------------------AQTMI-
MST1_Mmus        ------------------------------------------------------ANTMI-
F14H12.4_Cele    ---------------------------------------------------G--ESTLV-
CG11228_Dmel     ---------------------------------------------------S--DATMI-
DDB0216375_Ddis  ---------------------------------------------------N--KSGTTT
Krs1_Ddis        ---------------------------------------------------G--EDNDE-
1462_Tthe        ------------------------------------------------------FQDYI-
17909_Tthe       -----------------------------SDQES--------------E--D--TENYI-
29596_Tthe       FQQQ-QNSNNNNNNNSNNLNEQNQPDS-HLNSEV--------------E--NV-SSVVV-
5838_Tthe        FGINCNQSPNNNFNI------QNNINVQIINTSI-------------SEDNSVTNNTNI-
MST_Spur         ---------------ANTFIEHD-------DVTDIDSGTMIEHGTMIDH--D--SGTMI-
AqueK233_Aque    ------------------------------------------------------SNTMI-
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------DGTVI-


MST2_Hsap        -EHN--------------------------------------------------------
MST1_Hsap        -EHD--------------------------------------------------------
MST2_Mmus        -EHN--------------------------------------------------------
MST1_Mmus        -EHG--------------------------------------------------------
F14H12.4_Cele    -QHK-DNYV---------------------------------------------------
CG11228_Dmel     -AHA-EQGVDEGTLGPGGLRNLSKAAAPAAASSAASPL----------------------
DDB0216375_Ddis  NDYH------TG--------------------------NGRTSSS--S----P-------
Krs1_Ddis        -EYD------TG--------------------------TM--------------------
1462_Tthe        -AN------DSG--------------------------TV--IEY--Q----N-------
17909_Tthe       -EE------ESS--------------------------SM--TDN--K----S-------
29596_Tthe       -KE------DNGQ-----------LSNNLYAAM-----TY--TKY-------M-------
5838_Tthe        -NY------GVGR-----------INNFFNQAS-----SK--SSIHKG----C-------
MST_Spur         -EHGTMIDHDSGTMVDHD----------------S--GTM--IDH--D----SGTMVDHH
AqueK233_Aque    -QRG------------------------------Y--P----------------------
MST-1_Smoe       -VHR-TSSL---------------------------------TAQ--SS-----------
MST-2_Smoe       -VHR-TSSL---------------------------------TAQ--SS-----------
GK080_Glam       -MHG-KVLR---------------------------------QGE--SSDVPV-------


MST2_Hsap        -----------------------------------------------S-TM---------
MST1_Hsap        -----------------------------------------------D-T----------
MST2_Mmus        -----------------------------------------------S-TM---------
MST1_Mmus        -----------------------------------------------D-T----------
F14H12.4_Cele    ------------------------------------T-----------AQS---------
CG11228_Dmel     D------------------MPAV----------DSGT-----------MVE---------
DDB0216375_Ddis  ------------------QFG----------------L-----QHQNSSNS---------
Krs1_Ddis        -------------------------------------V-----IT-----D---------
1462_Tthe        YDQFNNEPDQHQQFYKKQNQF----------------INNNNDKQ-NN-FI---------
17909_Tthe       ------------------KSH----------------S-----QN-QS-TKFKKQ-----
29596_Tthe       ------------------NQN----------------I-----RG-FD-QAMDEKHRNNI
5838_Tthe        ------------------N-------------------------S-QQ-NSSRKHYQNQQ
MST_Spur         S-----------------GTM-IDHDSGTMVDHDSGTM-----INHGSLND---------
AqueK233_Aque    D------------------SI----------------I-----IN--E-P----------
MST-1_Smoe       D------------------LL----------------Q-----LNQSS-TD---------
MST-2_Smoe       D------------------LL----------------P-----LNQSS-TD---------
GK080_Glam       G------------------TI----------------------VRSGS-TD---------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ------------------------------------------------------------
17909_Tthe       ---------------------PKSSQFNDD-EEEEEEYSESG---------------QYS
29596_Tthe       LNSLPFNQQAAQQQYDYSEDQFIDHLSNEDYDDEEED--DEH-------------FDEHN
5838_Tthe        DSKRPQSSNTKEQ--------PHDINSSSD-DIENDDYDQQELHYAKDCFLNPNNFKN--
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ---------------------------------------------LESDLGTMVINSEDE
MST1_Hsap        ---------------------------------------------LPSQLGTMVINAEDE
MST2_Mmus        ---------------------------------------------LESDLGTMVINSEEE
MST1_Mmus        ---------------------------------------------LPSQLGTMVINTEDE
F14H12.4_Cele    ---------------------------------------------LRSQMESLRIGGEIP
CG11228_Dmel     ---------------------------------------------LESNLGTMVINSDSD
DDB0216375_Ddis  ---------------------------------------------FPSSPNTVPSVES--
Krs1_Ddis        ---------------------------------------------NKNSYDTVVFNND--
1462_Tthe        ---------------------------------------------WENETGTMVEKLEND
17909_Tthe       QTDQESQQESQVHLDEKSLKQQMLKKQQEKYSIDSSKQILQKDRLIENNLQQLVSKRKQD
29596_Tthe       KNN----------------------------------------NNIEDDEDDLSFHQEDY
5838_Tthe        ------------SIK----QNS--------------------------------------
MST_Spur         ---------------------------------------------LESNMGTMVINDDDD
AqueK233_Aque    ---------------------------------------------TVSDLGTLVIVDDD-
MST-1_Smoe       ---------------------------------------------LQGDNPTVKSNAKVE
MST-2_Smoe       ---------------------------------------------LQGDNATVKSNAKVE
GK080_Glam       ---------------------------------------------TPIGDGEILISADEN


MST2_Hsap        EE------E---------------------------------------------------
MST1_Hsap        E-------E---------------------------------------------------
MST2_Mmus        EEEEEEEEE---------------------------------------------------
MST1_Mmus        E-------E---------------------------------------------------
F14H12.4_Cele    KSAY--------------------------------------------------------
CG11228_Dmel     DST---------------------------------------------------------
DDB0216375_Ddis  ------KPR---------------------------------------------------
Krs1_Ddis        ------DED---------------------------------------------------
1462_Tthe        DGE---------------------------------------------------------
17909_Tthe       DSA-----TDLKQLSKKLNERSDDLNQLS-----KGK-----------------------
29596_Tthe       KK----------------------------------------------------------
5838_Tthe        ---------FIKNISKALSEQNFSLKSIQRTQMEQILTSPRGNNIEYQQQEKDQEDQNRF
MST_Spur         SG------N---------------------------------------------------
AqueK233_Aque    E-------G---------------------------------------------------
MST-1_Smoe       S-------E---------------------------------------------------
MST-2_Smoe       S-------E---------------------------------------------------
GK080_Glam       G-------E---------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ------------------------------------------------------------
17909_Tthe       --------------------------------------LNQNGNLGLSSK-SKELVEKYS
29596_Tthe       ------------------------------------------------------------
5838_Tthe        SRHSKFKNIRNRQVSPNIQQEHSRQNSKSANRYTSEDDSSQNGSNIIIKNQNSIIEEKIS
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ----------------D-----------------GTMK--R----------NAT----SP
MST1_Hsap        ----------------E-----------------GTMK--R----------RDE----TM
MST2_Mmus        ----------------D-----------------GTMK--R----------NAT----SP
MST1_Mmus        ----------------E-----------------GTMK--R----------RDE----TM
F14H12.4_Cele    -----------------------------------SSS--K----------NGN------
CG11228_Dmel     -----------------------------------TAK--N----------NDD----Q-
DDB0216375_Ddis  ----------------QPASELDDLLEEMMNPSFGNRA--RNSSGGGGGLTPIG----SP
Krs1_Ddis        ----------------S-----------------GTMK--L----------KNT----MP
1462_Tthe        ----------------------------------DEEQ--K----------DDN----LK
17909_Tthe       KNNQEL----------N-----------------DTSK--E----------NSEYDLDQL
29596_Tthe       ----------------E-----------------QMMK--K-------------IQVKYV
5838_Tthe        KINQSQPNTSRKQTNQQ-----------------NEQL--K----------NDT----SI
MST_Spur         ----------------D-----------------GTMK--R----------TDT----AK
AqueK233_Aque    ----------------D-----------------STMK--R----------VDT----DK
MST-1_Smoe       ----------------K-------------------------------------------
MST-2_Smoe       ----------------N-------------------------------------------
GK080_Glam       ----------------Y-----------------GTVTIVR----------GNS----LS


MST2_Hsap        ----------------------Q--------------------------VQ---------
MST1_Hsap        ----------------------Q--------------------------PA---------
MST2_Mmus        ----------------------Q--------------------------VQ---------
MST1_Mmus        ----------------------Q--------------------------PA---------
F14H12.4_Cele    ---------SP-----------R--------------------------VQ---------
CG11228_Dmel     ---------KPR----------N--------------------------RY---------
DDB0216375_Ddis  -----------ITKR-------P--------------------------TPTMQSSTTTT
Krs1_Ddis        ------------SNK-------K--------------------------NF---------
1462_Tthe        ----------------------Q--------------------------PE---------
17909_Tthe       ----------------------GQIL-K------------------DSKEL---------
29596_Tthe       ----------------------QPQQSVAPKQNGQQQILFQVTENDEQYLQ---------
5838_Tthe        ----------------------Q--------------------------KQ---------
MST_Spur         -----------A----------D--------------------------AY---------
AqueK233_Aque    ---------DSK----------E--------------------------PY---------
MST-1_Smoe       -VVGEERHDEPVIAAPIDLPPFS--------------------------PA---------
MST-2_Smoe       -VVGEERHDEPVIAAPIDLPPFS--------------------------PA---------
GK080_Glam       NDAANTHSTELNISAQISVDPVN--------------------------T----------


MST2_Hsap        -----------------------------------------RPSFMD-------------
MST1_Hsap        -----------------------------------------KPSFLE-------------
MST2_Mmus        -----------------------------------------RPSFMD-------------
MST1_Mmus        -----------------------------------------KPSFLE-------------
F14H12.4_Cele    -----------------------------------------PPGHTA-------------
CG11228_Dmel     -----------------------------------------RPQFLE-------------
DDB0216375_Ddis  TSSSSLPLPMSPSVYLSPTRVSGIWSGESAGGCANTTLWRKNPQYLL-------------
Krs1_Ddis        -----------------------------------------VPDYM--------------
1462_Tthe        -----------------------------------------NSDFMK-------------
17909_Tthe       -----------------------------------------KPQQMDKDKKKQGFEIDQN
29596_Tthe       -----------------------------------------QKHFLEQKQQ---------
5838_Tthe        -----------------------------------------DATNTEL------------
MST_Spur         -----------------------------------------KPQYLE-------------
AqueK233_Aque    -----------------------------------------KPHFMH-------------
MST-1_Smoe       -----------------------------------------TPPSLS-------------
MST-2_Smoe       -----------------------------------------TPPSLS-------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ----------YFDKQD-FKNKS-H------------------------------------
MST1_Hsap        ----------YFEQKE-KENQI-N------------------------------------
MST2_Mmus        ----------YFDKQD-FKNKS-H------------------------------------
MST1_Mmus        ----------YFEQKE-KENQI-N------------------------------------
F14H12.4_Cele    -----------SASDP-SK-----------------------------------------
CG11228_Dmel     ----------HFDRKN-AGDGL-L------------------------------------
DDB0216375_Ddis  ----------Q-------------------------ITATTTIRITLRQTGDKLVHIGFY
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ----------QFSKKE-DGFQNIN------------------------------------
17909_Tthe       EKYKQPQAKQNTQQKN-ENKQN-L------------------------------------
29596_Tthe       -------EQIYFQQQN-AQKQQ-Q------------------------------------
5838_Tthe        --DKQP--------NQCNN-----------------------------------------
MST_Spur         ----------HYERQE-EAKQA-K------------------------------------
AqueK233_Aque    ----------HFNKEP-DHNKK-Q------------------------------------
MST-1_Smoe       ----------PNQQLS-NESQT-LRRRKSPGDGASTVGGTTPRNLGGFALHDKLVSI---
MST-2_Smoe       ----------PNQQLS-NENQT-LRRRKSPGDGATTVGGTTPRNLGGFALHDKLVSI---
GK080_Glam       -----------------------LKQ----------------------------------


MST2_Hsap        -EN---------------------------------------------------------
MST1_Hsap        -S----------------------------------------------------------
MST2_Mmus        -EN---------------------------------------------------------
MST1_Mmus        -S----------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     -MA------YPLM-----------------------------------------------
DDB0216375_Ddis  FARS----------NTGANDQFRRRITLTKEYLVPGLDITF-LKSTEVSAKITMEPGYYV
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        -WAQNKKEDS---------------------------------------SF---------
17909_Tthe       -QS---K-DEQ---------------------LGNKK-KITHIDE---------------
29596_Tthe       -PS---QQVNPLH-NQQE--------------IPPQQ-KINYQDT---------------
5838_Tthe        -------QINQVSQKTIQ--------------------VPK-LQLSDQNSM---------
MST_Spur         -I----------------------------------------------------------
AqueK233_Aque    -GN---------------------------------------------------------
MST-1_Smoe       YAAG----------NTVP--------------------IPF-LRATDISAI---------
MST-2_Smoe       YAAG----------NTVP--------------------IPF-LRATDISAI---------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    -------------------N-------------------QP-------FA-------QDG
CG11228_Dmel     -------------------N-------------------EQ-------LI-------ALN
DDB0216375_Ddis  IIPATFEPNQEGSFELDVTATSDNIGG---------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ------------------SN-------------------KP-------NSNLQK----NN
17909_Tthe       --------------------LDDDDMSQYNSNTM-VINKDVDQPINKEFVECARQMESKG
29596_Tthe       ----------------------------YSQHKQ-HINNQI----------------KES
5838_Tthe        ------------------KNNLDEVYNY-SSSNRNKLNNNSS---NKSEQNNFNNANQNN
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------ALLSDDVLG---------------------------------
MST-2_Smoe       ------------------ALLSDDVLG---------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  -------------------Q-YN-S-----------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        SIGNKSEQREMTSQYNQIEQ-EDDQVNSSVIIKEDYEIEHIK------NQAYSGVAVTDS
17909_Tthe       ----------------MLGN-FKQENQKAASQKQQNENK---------------------
29596_Tthe       ----------------NSKE-FQ-SSASAALQKTDQKNQNIQ------NQQIN--DVNN-
5838_Tthe        ---------------IQISM-FNK-ETNFSMLNS-QQNQQMTNNKMNSQQNL--------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       -------------------NGFA-DH----------------------------------
MST-2_Smoe       -------------------NGFA-DH----------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ----------------------C----------------NQN--MHEPFPMSKNV-----
MST1_Hsap        ----------------------F----------------GKS--V--PGPLKNS------
MST2_Mmus        ----------------------C----------------DQS--MREPGPMSNSV-----
MST1_Mmus        ----------------------F----------------GKN--V--SGSLKNS------
F14H12.4_Cele    ----------------------T----------------GPNFQLGTSESSYKD------
CG11228_Dmel     ----------------------N----------------QPNLLLSNAAPMGQQ------
DDB0216375_Ddis  ----------------------N----------------N-----N----IKLS------
Krs1_Ddis        ---------------------------------------N-----Q----FKKS------
1462_Tthe        EKKIQQKNVPDFVLFAQKMEENN----------------NKN--FPK-KPLNINIQTDNI
17909_Tthe       -----------------------------------------------------NH-----
29596_Tthe       ----------------------I----------------QKK--DDEKVVLQSNQFPQNV
5838_Tthe        --------------------------------------------------T---VNN---
MST_Spur         ---------------------------------------SSP--V--TPPINPSNA----
AqueK233_Aque    ---------------------------------------KKN--A-HVGPQSIY------
MST-1_Smoe       ----------------------SGAVALQTVEELYNAAGVAD--STFKK-----------
MST-2_Smoe       ----------------------SGAVALQTVEELYNAAGVAD--STFKK-----------
GK080_Glam       ------------------------------------EDCVED--LDGPS-----------


MST2_Hsap        --------------------------------FP---------------DNWKV--PQDG
MST1_Hsap        -------------------------------------------------SDWKI--PQDG
MST2_Mmus        --------------------------------FP---------------DNWRV--PQDG
MST1_Mmus        -------------------------------------------------SDWKI--PQDG
F14H12.4_Cele    -------------------ASYNMMNTEAE--YE----------N----RFQRA--VVDG
CG11228_Dmel     --GI---------------PAAAPAQPPPA--YQ----------NQHMHTQSHA--YVEG
DDB0216375_Ddis  -----------------------------EIKGD---------------RDWRI--ISDR
Krs1_Ddis        --------------------------------DD---------------DVTNV--PLS-
1462_Tthe        HIQVPQSSTPQQQKQ-----------QT---------------------TKQSI--SEDS
17909_Tthe       -------------------------------------------------LQQQI--QSQN
29596_Tthe       -----EEDDYQDIQIQVYDAQIDENNNI---------------------YEIHI--PNDG
5838_Tthe        -------------------------------------------------SNKII--PQWI
MST_Spur         -PTVPSNAPMHIAPGNHRVSAP----------PPANQEAPPPKPPL---FLHRP--FSEM
AqueK233_Aque    ---------------------------------A---------------YFPAI--PEGT
MST-1_Smoe       --------------------GK----------KPGTS-------------ETPL--PASV
MST-2_Smoe       --------------------GK----------KPGTS-------------ETPL--PASV
GK080_Glam       --------------------AS----------PPTKT-------------KEPRGKPAKG


MST2_Hsap        DF----------------------------------------------------------
MST1_Hsap        DY----------------------------------------------------------
MST2_Mmus        DF----------------------------------------------------------
MST1_Mmus        DY----------------------------------------------------------
F14H12.4_Cele    DF----------------------------------------------------------
CG11228_Dmel     EF----------------------------------------------------------
DDB0216375_Ddis  -FEWRGSSAGGSFSGSSATWKDNPKFFFETTQTSNTTIVLGKLSDIPKETYIGFYIFKAD
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        DIP---------------------------------------------------------
17909_Tthe       KQ----------------------------------------------------------
29596_Tthe       EN----------------------------------------------------------
5838_Tthe        NY----------------------------------------------------------
MST_Spur         DF----------------------------------------------------------
AqueK233_Aque    EFK---------------------------------------------------------
MST-1_Smoe       YQ----------------------------------------------------------
MST-2_Smoe       YQ----------------------------------------------------------
GK080_Glam       P-----------------------------------------------------------


MST2_Hsap        -------------------------------------------------DFL--------
MST1_Hsap        -------------------------------------------------EFL--------
MST2_Mmus        -------------------------------------------------DFL--------
MST1_Mmus        -------------------------------------------------EFL--------
F14H12.4_Cele    -------------------------------------------------EFL--------
CG11228_Dmel     -------------------------------------------------EFL--------
DDB0216375_Ddis  KNCPFISLTANNLYSKTSFVNGIEVVHTQQQMPPGCYIIVPCTYDSRQEGSFTLTCYSDC
Krs1_Ddis        -------------------------------------------------DKY--------
1462_Tthe        -------------------------------------------------SEY--------
17909_Tthe       -------------------------------------------------ENK--------
29596_Tthe       -------------------------------------------------NEE--------
5838_Tthe        -------------------------------------------------SQY--------
MST_Spur         -------------------------------------------------DFL--------
AqueK233_Aque    -------------------------------------------------DYL--------
MST-1_Smoe       -------------------------------------------------SLA--------
MST-2_Smoe       -------------------------------------------------SLA--------
GK080_Glam       --------------------------------------------------KG--------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  QQGSIYKLDLSEQILTVHGEW----------------RGATSGGCLN-HTTWRNNAQYLI
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ------------------------------------------------------------
17909_Tthe       ------------------------------------------------------------
29596_Tthe       KVP---------------------------------------------------------
5838_Tthe        QKLSNS--------------KQQTDKKEQQLQFREEDQLTIKKLPENINSSIINNNQHNL
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  HN----------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        ------------------------------------------------------------
17909_Tthe       ------------------------------------------------------------
29596_Tthe       -------------------------------------SHRIVRPLKRQG-----------
5838_Tthe        EETPCKSEKAQLILQTTEKIKKYSSDQSNSNDVFNVDT-------VNNRNKYNQEQNTKI
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ---------------------------------------------------KNLS-----
MST1_Hsap        ---------------------------------------------------KSWT-----
MST2_Mmus        ---------------------------------------------------KNLS-----
MST1_Mmus        ---------------------------------------------------KSWT-----
F14H12.4_Cele    ---------------------------------------------------RNIT-----
CG11228_Dmel     ---------------------------------------------------KFLT-----
DDB0216375_Ddis  ---------------------------------------------------TSSSPTKVT
Krs1_Ddis        ---------------------------------------------------SSYS-----
1462_Tthe        ---------------------------------------------------KNMN-----
17909_Tthe       ---------------------------------------------------NQVP-----
29596_Tthe       ------------------------------------HAADY----------EEFE-----
5838_Tthe        NQQECISNFSLLQIPSSQNITNSQNNHSQYIQQSPIKNSDYNQNHLFTPNNSSQT-----
MST_Spur         ---------------------------------------------------KQLS-----
AqueK233_Aque    ---------------------------------------------------KGLN-----
MST-1_Smoe       ---------------------------------------------------TSST-----
MST-2_Smoe       ---------------------------------------------------TSST-----
GK080_Glam       ---------------------------------------------------SKGT-----


MST2_Hsap        -------------------------LE---------------------------------
MST1_Hsap        -------------------------VE---------------------------------
MST2_Mmus        -------------------------LE---------------------------------
MST1_Mmus        -------------------------VE---------------------------------
F14H12.4_Cele    -------------------------LD---------------------------------
CG11228_Dmel     -------------------------FD---------------------------------
DDB0216375_Ddis  IMLEQLEKMDNQQLPFVGFYVAKSPTP---------------------------------
Krs1_Ddis        -------------------------LE---------------------------------
1462_Tthe        -------------------------EQ---------------------------------
17909_Tthe       -------------------------LD---------------------------------
29596_Tthe       -------------------------ET---------------------------------
5838_Tthe        -------------------------KQDLNNQKQQLSNNTINTNITLIERLPTNNFDSQF
MST_Spur         -------------------------ID---------------------------------
AqueK233_Aque    -------------------------DD---------------------------------
MST-1_Smoe       -------------------------LQ---------------------------------
MST-2_Smoe       -------------------------LQ---------------------------------
GK080_Glam       -------------------------LS---------------------------------


MST2_Hsap        -----------------------ELQMRLKALDPMMER--------------EIEEL---
MST1_Hsap        -----------------------DLQKRLLALDPMMEQ--------------EIEEI---
MST2_Mmus        -----------------------ELQMRLKALDPMMER--------------EIEEL---
MST1_Mmus        -----------------------DLQKRLLALDPMMEQ--------------EMEEI---
F14H12.4_Cele    -----------------------ELIRRKESLDSEMEE--------------EIREL---
CG11228_Dmel     -----------------------DLNQRLCNIDHEMEL--------------EIEQL---
DDB0216375_Ddis  -----------------------NLDKKLFSLTPKDIV--------------GNTEF---
Krs1_Ddis        -----------------------ELKKMLAELEIEREK--------------EVQKT---
1462_Tthe        -----------------------QIETMIETLKKELEM--------------ELKAI---
17909_Tthe       -----------------------QLQSKLQKLEKEMLL--------------EIEVI---
29596_Tthe       -----------------------KLLSKLDQLLKQQQL--------------EIQKI---
5838_Tthe        RSKPQNSPHFEQIQQQVIQKNLNNFQNTKAYNEKLNFQ--------------QIPQIQNK
MST_Spur         -----------------------ELRERLTSLDPQMEA--------------EIEEL---
AqueK233_Aque    -----------------------ELEEHMTLLDKRMDE--------------ELEAL---
MST-1_Smoe       -----------------------NLARALAY-HKRCYEEMP---------------L---
MST-2_Smoe       -----------------------NLARALAY-HKRCYEEMP---------------L---
GK080_Glam       -----------------------RRQKILAA-AAQEYEQASQIAQDMTREQLLVEKM---


MST2_Hsap        --RQRYTAKRQPILDAM-------------------------------------------
MST1_Hsap        --RQKYQSKRQPILDAI-------------------------------------------
MST2_Mmus        --HQRYSAKRQPILDAM-------------------------------------------
MST1_Mmus        --RQKYRSKRQPILDAI-------------------------------------------
F14H12.4_Cele    --QRRYKTKRQPILDVI-------------------------------------------
CG11228_Dmel     --NKKYNAKRQPIVDAM-------------------------------------------
DDB0216375_Ddis  --INDYQVHFTSIMEPNT------------------------------------------
Krs1_Ddis        --LEKFSINRQALLA---------------------------------------------
1462_Tthe        --QDAYSQKITRCEKALKLVKSKKNGSFTPTSLPMQLIQIPQNNNFVNQEPISPIKRNIN
17909_Tthe       --KDRYKKKIDDVLLNIQSHPD------PKASLTYQKCKKSSASLMK-------------
29596_Tthe       --QEKYKPQIEEIQKTLELIKKAQN-TYSQSNLTSQKVASSSNS-SHQITNSQINNFLLN
5838_Tthe        FTRQQNSSSQSPVMNFQQIS----------------------------------------
MST_Spur         --RKRYQEKRRPIIEAM-------------------------------------------
AqueK233_Aque    --RKRYHQKRQPILQAI-------------------------------------------
MST-1_Smoe       --QGWQAAQEERVIGNL-------------------------------------------
MST-2_Smoe       --QGWQAAQEERVIGNL-------------------------------------------
GK080_Glam       --TEKNPARLRVIKKAL-------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        NQLLPQQQQQYLPSPSSTAMKNNLEYLVSSPHLAPSALPQISQSPYIKNLNLVNGGVYDS
17909_Tthe       ------------------------------------------------------------
29596_Tthe       NNGVGVNMNHSQQLNNHNHHFSQQVSSSV-------------------------------
5838_Tthe        ------------------------------------------------------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        NNNSQNLLNGTSSNQIQNKLPNKGFNALQSSNNPMYTSTNNLVNQSSNNNPLTHLNPVLN
17909_Tthe       --------------------------------NISEIHLN----SSLLEFSESDLEKSVF
29596_Tthe       ----------------------------QAPQNVLNINTN----NSNNTHHLNHHDPRFF
5838_Tthe        ------------------------------------------------------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        NIYSEMPLPATPKTKEQAQQNNGGLNYALGVQTQPTSSNIYLTSCQKSSNNNSNIAQYTN
17909_Tthe       SQSKN-------------------------------------------------------
29596_Tthe       SVDSY-------------------------------------------------------
5838_Tthe        ------------------------------------------------------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        GQIPVQSQSNQQEDIINNIKRQFQITNSVLGNVESSNQQQQKQAIINNEMQLRKINSNHP
17909_Tthe       -------------------------------DLQLFEQMKNKLLEEDLKSQQKAKEKKSN
29596_Tthe       -------------------------------NLHAANQIQCNQIIENIQSQSHLISSNNS
5838_Tthe        ------------------------------------------------------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    ------------------------------------------------------------
MST-1_Smoe       ------------------------------------------------------------
MST-2_Smoe       ------------------------------------------------------------
GK080_Glam       ------------------------------------------------------------


MST2_Hsap        ------------------------------------------------------------
MST1_Hsap        ------------------------------------------------------------
MST2_Mmus        ------------------------------------------------------------
MST1_Mmus        ------------------------------------------------------------
F14H12.4_Cele    ------------------------------------------------------------
CG11228_Dmel     ------------------------------------------------------------
DDB0216375_Ddis  ------------------------------------------------------------
Krs1_Ddis        ------------------------------------------------------------
1462_Tthe        -INQLKNSKNNQLFESNMLNKQPSKPTSQNSNFSKGIQSSSPMITQGGGLSFEEALNRKN
17909_Tthe       TIEQHK------------------------------------------------------
29596_Tthe       QMQQMY------------------------------------------------------
5838_Tthe        ------------------------------------------------------------
MST_Spur         ------------------------------------------------------------
AqueK233_Aque    -------------------------------------