Protein (view, download) , Domain (view, download)
2332_Tthe        YEIFEILGKGSF--GQVFKAKK-------------NGKIYALKLLDLHM-IKQ-R-----
9454_Tthe        TSKENILGSGTQ--ATVYLAKRSTD-----------ELTVAAKIFDMTQ-NFSE------
16220_Tthe       YIKQKQIGGGQY--GKVFEAKDKQ----------NVFQNIAIKQVNLQY-----------
19068_Tthe       YTLIQKLGSGGF--SSVYLCEDE------------NQNKFALKKIREV------------
22937_Tthe       ------------------------------------------------------------
26140_Tthe       YKVVKQIGQGTF--GTVYKCSTY------------KGYEYAIKQINNIK-M---------
28647_Tthe       YTLLQNLSSGPM--GKVYKCQK-------------NGKQYVIKIINFEN-S---------
5444_Tthe        YLFNKQIGRGNQ--GAIYLATVLNQ---KPVIQGEEQAQVAIKVVQHQA-LKAK------
8897_Tthe        YKVKQTLNSGSF--GTVFLAEDE------------NGKLFAIKRLQDD------------
ULK3_Hsap        FILTERLGSGTY--ATVYKAYAKK----------DTREVVAIKCVAKKS-LNK-------
ULK2_Hsap        YSKRDLVGHGAF--AVVFRGRHRQ----------KTDWEVAIKSINKKN-LSK-------
ULK1_Hsap        FSRKDLIGHGAF--AVVFKGRHRE----------KHDLEVAVKCINKKN-LAK-------
ULK4_Hsap        FILYEEIGRGSK--TVVYKGRRKG-----------TINFVAILCTDKCK-----------
T07F12.4_Cele    ------------------------------------------------------------
unc-51_Cele      YSKRDLLGHGAF--AIVYRGRYVD----------RTDVPVAIKAIAKKN-ISK-------
1348_Tthe        RVKDRILGEGSF--ANTYIAQLQND---------NSKKIYACKIIQKQQ-LIQKLLQANN
1349_Tthe        YMKNHVLGKGNF--AETYLATRVE----------DENQILACKMIAKQQ-IMEKLRRAPD
1429_Tthe        FQLSSVLGQGSF--GKVFKGKNTE-----------NGQLVAIKMIEKKQ-IQNDE-----
1439_Tthe        ICMKDILGSGSF--GVVYKCTD--K---------QN-EVWAAKQISKNL-INGK------
2103_Tthe        YIMANEIGKGSF--AKVFKGINSE-----------TGEKVAIKKIDKNK-FDK-------
2836_Tthe        LEDTDIVGEGSF--GKVVRAYDIK----------NQNEDLVAKIIPLDD-Q--Q------
3032_Tthe        VVVNKKLGKGAF--GTVFRGFCED----------DENKLVAAKQIPIKN-ISNSD-----
3104_Tthe        YTLHEALGSGQY--GKVYKALNVR-----------TNSLVAIKAVKVEK-FK--------
3833_Tthe        YNENSKLGAGGF--GAVYKGLEVPLEGQT-----LKDEYVAIKHVEIQEGIKNT------
4111_Tthe        ILVNHKLGRGSY--GTVYRGYLEQ----------DENQMIAAKQIPIKE-ICSST-----
5362_Tthe        WSEQDFLGKGAF--GSVFKGKNIE-----------TGEQVAVKVLQMQH-FK--------
5380_Tthe        YSLIKEIGQGSF--ARVYRGRTETN---------GVQEDFAIKMISKGY-LRE-------
5688_Tthe        WDNSGFLGEGSY--GKVYKGKDVK-----------TGELVAVKCMDMSQ-FT--------
6347_Tthe        YEVIKELGRGSF--GVVYLGIK-------------QGEELAIKTIKKDK-IQRSQ-----
6347~b_Tthe      ----------NF--VNNYLAIDTD----------NSNKLVIVKQVISDY-YT-L------
6603_Tthe        YVLERKIGSGQF--GDVFKGYNKV-----------NNQDIAIKVVKREL-LKG-------
7377_Tthe        WENRKFIGEGSF--GKVYRATNTK-----------TKQDVAVKVLDMKN-FK--------
8181_Tthe        VCTNKQLGQGAF--GQVVKGFLKD----------NHAQQVAVKIISLQK-VASES-----
8636_Tthe        YSLDEVIGSGQY--GKVYRATNIK-----------TNKVVAIKVVKIQK-FK--------
8696_Tthe        VVVNNVLGKGAF--GKVYRGFCVE----------DENKLVAAKAIPIKS-ISDSG-----
9457_Tthe        IVLNKPIGKGNQ--ATVYESYRKDN-----------LQIVAAKVFDLTQ-NGQT------
10447_Tthe       YFIDKKLGEGSF--GRVYKALDQK-----------SNEVVAIKQYLIKG-FIDNP-----
11042_Tthe       FSEDRLLGEGAF--GVVYKGEDKN-----------TKQKVAIKQISQSK-FQNDP-----
11253_Tthe       YVLKEVIGSGQY--GKVFKSTHQK-----------TGQVFAVKVIKLEK-FK--------
11660_Tthe       IYLKHKLGSGSY--GTVYLCKYNK-----------DQKFYACKMVLIGN-----------
13838_Tthe       LIDKEVLGKGAF--ATVVKGLDLK-----------NNQHIACKIVSKQK-LKENP-----
14572_Tthe       YNTRHCIGEGSY--GKVFEGIDVK-----------TQEKIAIKTIDQNI-FKNDQ-----
15010_Tthe       YIFIKQIGSGAY--STVHQGKHNQT-----------YQKVAIKMIPNSK-LNE-------
15044_Tthe       YRIIKTLGKGQY--GTVYLAIDSNQ-----------QQQFAVKQIFSQS-LINK------
15069_Tthe       YTLHEILGKGSF--GQVFKATK-------------NNKVYAIKMIDKPL-IRK-K-----
15675_Tthe       ------LGEGQY--GKVYEAAEQNN----------QSKRYAVKVIPSQI-FQ--------
15705_Tthe       IVFNEKLGGGQF--SQVYKAMDKND--------KTHEQYFAVKIIPMSS-TQYQ------
15762_Tthe       YQIVERLGKGSF--GSVYKAEK-------------DGKTYALKMISKSY-MKDRP-----
15836_Tthe       ----NELGGGSF--GKVYKAYKKD-----------TKEVVAIKQIPKEG-LNANP-----
15837_Tthe       YSIIEKIGEGCF--GRVYKGINLQQ-----------KEYVAIKQVPYQK-FRETA-----
16588_Tthe       IYQDKMLGNGSY--GQVFEGINKN-----------TKENVAIKVIPIKK-IEAES-----
18315_Tthe       YHIYEDIAKGKY--SIIYKARKKK-----------TIDYFAVKSMEKCK-----------
18701_Tthe       FNLNQRIGSGSY--ANVYKGEDRE-----------TGKAVAIKMIDRKK-ISQED-----
18780_Tthe       LQGKTELGKGAF--AIVYPGKDTH-----------KNKLVAIKKIDAIK-N-K-------
19558_Tthe       FSINYCLGQGEY--GKVFQGVNKI-----------TNEDVAIKQIDQRM-VQQ-------
19707_Tthe       YVLNEVIGSGQY--GKVYKAKNMN-----------NDQVVAIKVVKMDK-FR--------
20769_Tthe       YNLRHCLGEGAY--GKVYEGVEKN-----------TQQTVAIKKLDIRQ-FQNDN-----
20902_Tthe       IYKDRILGKGTF--GYVFQGENTK-----------NKQIVAIKMVPLKE-FKFK------
21109_Tthe       YITKQNLGKGAF--GSVFIAYRLTK-------EGKKNGKFAAKVIQLTT-LN--------
21913_Tthe       ------------------------------------------------------------
22048_Tthe       IEMNNQIGSGQH--GSVYMAHRKD----------FGVKKLACK----------I------
22049_Tthe       --MKHLLGKGTF--GEVYICWREK----------EPSIKFACKIIPISN-L---------
24363_Tthe       FNCSDTLGKGSF--GTVYKGRVIA-----------TNEVVAIKALNRSL-LQIQ------
24887_Tthe       FCLSDLVGKGAS--GTVYLGENSV-----------TKDLVAIKVIDLHQ-VKDE------
24896_Tthe       FSLSACIGKGSS--GTVYVGRHQQ-----------TQQVVAIKAVDMRS-LKTE------
26436_Tthe       YILLEHICQGTF--GEIHKGRNLI-----------SKEAVAVKTIQLEQ-FLNDS-----
26742_Tthe       YCLPDIIGKGYS--SKVYRGKNET-----------TGDTVAVKVIDMKG-IKNE------
27664_Tthe       LNLDKILGQGSF--GSVYQAIDMK----------NGDRQVAVKQISQTS-MNKNA-----
28079_Tthe       YQLIQRLDEGAI--GQVFKAQNIQ-----------TKEYVAVKQVNIKL-FSKSE-----
28933_Tthe       YQLNDQIGKGYS--SKVFKGKDER-----------TDEEVAVKVIDMKM-MSNE------
29387_Tthe       ------------------------------------------------------------
30213_Tthe       IISEQKLGEGGF--GTVYQGIDVI-----------NQKFVACKAVSIAK-LAQIP-----
ULK3_Spur        ------------------------------------------------------------
ULK1_Spur        YNKKDIIGHGAF--AIVFRGRERK----------RPDQTVAIKCINKKN-LSK-------
ULK4_Spur        ------------------------------------------------------------
ULK1_Mmus        FSRKDLIGHGAF--AVVFKGRHRE----------KHDLEVAVKCINKKN-LAK-------
ULK2_Mmus        YCKRDLVGHGAF--AVVFRGRHRQ----------KTDWEVAIKSINKKN-LSK-------
ULK3_Mmus        FILTERLGSGTY--ATVYKAYAKK----------DTREVVAIKCVAKKS-LNK-------
ULK4_Mmus        FVLYEEIGRGSR--TVVYKGRRKG-----------TINFVAILCTEKCK-----------
Apg1_Ddis        YILDKRIGWGAF--AQVYKGFSIK-----------TNEPFAIKVVDVCR-LADK------
CG10967_Dmel     YSSKDMLGHGAF--AVVYKGRHRK-----------KHMPVAIKCITKKG-QLK-------
CG8866_Dmel      FEILEKLGAGSY--ATVYKARHKK-----------QRTYHAIKYVEMST-LSQ-------
APG1_Scer        YTAEKEIGKGSF--ATVYRGHLTS----------DKSQHVAIKEVSRAK-LKN-------
13031_Tthe       --------KGSF--GQIRRVYDLE----------NTQKKLCCKIISIKD-F--K------
9755_Tthe        ------LGQGQF--GKVMKAYDLN----------RKQLDLAVKIIPKNK-L--K------
DDB0230007_Ddis  ------------------------------------------------------------
CC1G_15592_Ccin  YIIVSDIGRGSF--ATVYKGYHEE-----------TRLQVAIKAVKRDN-LSA-------
AqueK210_Aque    ------------------------------------------------------------
AqueK211_Aque    ------------------------------------------------------------
AqueK212_Aque    LILMECLGSGSY--ATVYKAMMKS-----------NKRIVAVKCIERKR-LNS-------
AqueK213_Aque    YRPGELIGHGAF--ALVFKGQHRQ-----------TRQAVAIKQILLKN-IPG-------
AqueK214_Aque    ------------------------------------------------------------
AqueK215_Aque    WDLKSLLGKGSY--GNVYKGWNSQ-----------KTAEVAVKVVRKDL-FRQDP-----
ULK_a_Smoe       YRLLHKIGVGSF--ATVWKAMHKI-----------TGEIVAIKVIVPRM-DQLR------
ULK_c_Smoe       YITSQEIGAGSF--AVVWKARHKI-----------TGHEVAIKEIGTEK-LNK-------
ULK_d_Smoe       YITSQEIGAGSF--AVVWKARHKI-----------TGHEVAIKEIGTEK-LNK-------
ULK_b_Smoe       ------------------------------------------------------------
GK070_Glam       FKTYEEIGRGKNSGSIIYRARQPQ-----------SLEYVAAKQTPTRI--Q--------


2332_Tthe        ------NIERFVSNEINLMKK---MN---H-KN-IVKIYETFQ-----TT---SV-IFLV
9454_Tthe        ------KDQESIKRQLDILFT---TK---H-PY-ILECYDFI-----QT---KHN-IYLF
16220_Tthe       ----------VRPNEKEIWKQ---IK---G-QY-VVELYDCV-----QDE---QN-MYFI
19068_Tthe       -------KERYIQQELKALMT---IK---S-PY-IVKYVENFV-----YK---EY-PIII
22937_Tthe       ---------------------------------------------------------FLV
26140_Tthe       --------KKMMNNELDALKS---VN---S-KY-VVRYYEVFYD----KQ---DH-PCIV
28647_Tthe       ---------KSAKRQIEALKK---LQ---N-TNFIVKIVDSFQ-----ND---NH-FCFV
5444_Tthe        -------EKELLQNEIQALKE---ID---S-NY-VVKCIECL-----ND---QEN-TYIV
8897_Tthe        -------NKQLLETELTALKS---IK---G-EN-IVEMVEFFY-----DQ-HTQL-PLIV
ULK3_Hsap        ----A--SVENLLTEIEILKG---IR---H-PH-IVQLKDFQ-----WDS---DN-IYLI
ULK2_Hsap        -------SQILLGKEIKILKE---LQ---H-EN-IVALYDVQ-----ELP---NS-VFLV
ULK1_Hsap        -------SQTLLGKEIKILKE---LK---H-EN-IVALYDFQ-----EMA---NS-VYLV
ULK4_Hsap        --------RPEITNWVRLTRE---IK---H-KN-IVTFHEWY-----ETS---NH-LWLV
T07F12.4_Cele    -------KVHVKESELKMIKE---LN---S-EY-LVGVLDICN-----FD---DFFCCLI
unc-51_Cele      -------SKNLLTKEIKILKELSSLK---H-EN-LVGLLKCT-----ETP---TH-VYLV
1348_Tthe        PHEKQEFFLKALYNEVEVWKT---L---DH-SN-IVRFYDYS-----ETA---NN-YYFI
1349_Tthe        PEGRKKYIIDALKNEVQLWKE---L---DH-PN-IVKFIDFS-----ETP---NN-IYFF
1429_Tthe        ------YLMNGLFSEIQIMKK---LK---S-EY-VVDLIDVL-----ETS---NN-YYII
1439_Tthe        ----KDYLEKLLRQEVGVQKQ---M---KS-EN-IVRLKEFL-----ISD---NN-YYLI
2103_Tthe        ------QYLELIDSEISVLSQ---LN---N-EH-IIKFLDLFN-----EG---DY-IYIV
2836_Tthe        ------K-YESMQMELKVLCK---LP--QH-VN-LVNYKKIKM----SSQ---NK-QYFI
3032_Tthe        ------KMIKLIKREINNLQK---LD---S-KY-IVKLYDVS-----RTP---NN-LYMF
3104_Tthe        ---EVPKLEEFTMNEIQTLAR---IN---N-PY-IVKFIEML-----KTK---NH-YYFV
3833_Tthe        ---VNNIELESVRQEIVTLQQ---LD---H-PN-IVQLIDVK-----KNK---DN-VYMV
4111_Tthe        ------SRIQYIKREIENLQK---ID---S-KY-VVKLFGVS-----RTQ---TN-LYMF
5362_Tthe        ---NEQ-AKIQLDEEINVMKK---LD---S-PY-IVKLLGLQ-----EEN---EQ-TVII
5380_Tthe        ------DNQELIDKEISILLK---LR---H-KN-IIRLVDFK-----KT---TNN-WYLI
5688_Tthe        ---DQF-MKESLENEIGVMKI---LH---S-NN-VVRMLHCE-----QDK---KT-TYII
6347_Tthe        ------KLTELLDSEKQLLST---IK---S-NH-ITKLFEFFE-----TD---KN-CFLA
6347~b_Tthe      ---KEYNQTDQIKQVFKIIQK---IN---Q-EN-ILKINLIT-----MSK---NK-FYIV
6603_Tthe        ------KFNELLENEIRVLRT---CN---N-EN-IIKLYDIK-----KTA---NN-FYLM
7377_Tthe        ---QQD-MIASLKNEIQIMKQ---LK---S-PN-IVRLLDCS-----GNT---KE-TFIF
8181_Tthe        ------NFIKLLRREIEILQK---IN---H-PN-IVKLHYAT-----RTT---NN-LYMF
8636_Tthe        ---ENPKLEECTVNEIKTLSQ---MD--DN-RH-VVSFIELL-----RSS---NN-YYFV
8696_Tthe        ------KMLELIKREIAILQK---VS---S-PF-IVSLYDVA-----RTS---NN-LYMF
9457_Tthe        ------NQARNLQRQVKILTT---LK---H-PY-ILECFDIK-----QT---QKN-QYFF
10447_Tthe       ------KLQQLFNQELKILKQ---LN---S-KH-VIRYIDDF-----SN---SDS-HFLV
11042_Tthe       ------IVLKNLKREIEIMQD---LK---H-EN-IVQLFNFT-----YTA---SN-VYII
11253_Tthe       ---SVPKLHEFTNNEIQTLTK---LN---N-PN-VITFIEML-----RTS---NN-VYLV
11660_Tthe       --------YNDVLQEMHVAQE---VK---G-KY-ICELYFAG-----MSS---NY-LYLI
13838_Tthe       ------TLDNLFAQEIQLQRQ---LK---S-PY-IIQLYKVYS-----VD---NY-YMLM
14572_Tthe       ------YLQCAIMAEIEILKR---FD---H-KN-IVKFKDIV-----YED---DT-IYII
15010_Tthe       ------TIYQRVVSEIKILTR---LN---H-PN-IVRIIDFK-----KT---SQN-YYLI
15044_Tthe       ------KLNELLNQELTIQKI---IK---S-QH-TVQVIEDF-----FD-QNFKT-HIII
15069_Tthe       ------NLQKYVNNEVKVMRE---LK---N-QN-TVRLYEAFE-----DK---DI-LYLV
15675_Tthe       ---QSMSNSQMLQKEIDVLKK---L---RH-EN-LVCLHEIS-----QSP---NN-LYLF
15705_Tthe       ---KFANYNQLLQKEIEILLK---A---RH-QN-LICMHDLK-----QTP---NN-LYLF
15762_Tthe       ------FLRKYIQNEIESMKS---IN---C-VN-CVKLYDYFE-----TN---LA-HFFV
15836_Tthe       ------KLQQLYNSEVSLLKI---LS---S-EN-IIKYIDNF-----NT---TDC-CYIV
15837_Tthe       ------KVRELFNSEVKILKA---VK---N-EN-VVGYVDYF-----EC---LEA-AFLV
16588_Tthe       --QNPQVIFQQIKNEITNMQL---IE---G-QH-IVKLID---------K---KN-IYLI
18315_Tthe       --------RKKLMNEVKIFNL---LD---H-VN-ILKYYNWY-----ETK---NH-LWAI
18701_Tthe       ------YLMNGLLQEIQIMKK---LD---S-NY-IVKLIDVL-----ETK---NN-YYIV
18780_Tthe       ------DYLDKIDQECQLHQS---LL--HN-CH-VLEFIDNFS-----EE---NY-IYII
19558_Tthe       ----DQYIKQSLQREIEALKK---IK---H-PN-VIELKDVY-----YSD---NY-IYII
19707_Tthe       ---EIPKLHEFTMNEIRTLAK---ID---N-PN-CVKFQEML-----KTS---NN-MYLI
20769_Tthe       ------YLRNSIISEIEILKR---FN---H-KN-IVKFIDLI-----TTQ---RS-LYII
20902_Tthe       ---PE-KIIPSLKNEIKNMQM---LH---H-KN-TVQLYDVI-----KTD---NN-LYMV
21109_Tthe       ---DK--EIIQLTREIEILKT---I---RH-DN-IVKMEHVT-----RTK---NN-LYLF
21913_Tthe       --------LKKVLNEVKIFHS---LN---H-PN-IMRFYNWY-----ETR---NH-LWVI
22048_Tthe       ---QQSN-RNQIKEEISIIKE---VN---G-IY-IAEVLDVY-----KTS---SY-IYIF
22049_Tthe       ---EQDK-LKQSLEEGRLLML---AQ---G-KN-IVPMITFI-----KSP---NN-FYYI
24363_Tthe       ---NQKFMIDQLKKEINLMQE---IK---S-EH-IVRIYDLV-----GTE---TH-IYII
24887_Tthe       ------YTWGLICSEIDIMKK---LK---C-EN-VVKLIDVF-----QTQ---NN-AYII
24896_Tthe       ------YAWKMLCSEVKIMKK---LK---H-PH-VVRLLDVF-----QTK---NN-TYII
26436_Tthe       ------VLRDMIINEIQALKK---LE---D-PN-IIRMIKML-----KSS---NN-IYLI
26742_Tthe       ------VQSFLLKNEISVLKK---LN---N-IN-CLKLFDVF-----HTA---NN-TYII
27664_Tthe       -----DKLMQLLKNEIKTMKM---IK---D-KN-VVQLLDVR-----RSS---NN-IYLI
28079_Tthe       ------HLYTLFEQEIENLKK---TK---S-VN-TIKYIDHF-----ND---DNN-KYIV
28933_Tthe       ------VQLFLLQNEISVMKK---LALTGN-IN-ILKLNDVF-----QTA---NN-TYII
29387_Tthe       --------QEDVLKELQVAQE---IR---G-EF-ICELKYAG-----ASA---NF-LYLI
30213_Tthe       ------KLVELFAQEIALQQK---LK---S-PF-TVELYKVYK-----CQ---DH-FYLI
ULK3_Spur        -----------------------------------------------WDQ---HY-IYLI
ULK1_Spur        -------SQTFPEKEIEILKE---LH---H-GN-VVSLLHFK-----ETT---SS-LFMV
ULK4_Spur        -----------VTNRVRLTHE---LS---H-SN-IVEFYEWY-----ETT---NH-LWLI
ULK1_Mmus        -------SQTLLGKEIKILKE---LK---H-EN-IVALYDFQ-----EMA---NS-VYLV
ULK2_Mmus        -------SQILLGKEIKILKE---LQ---H-EN-IVALYDVQ-----ELP---NS-VFLV
ULK3_Mmus        ----A--SVENLLTEIEILKG---IR---H-PH-IVQLKDFQ-----WDN---DN-IYLI
ULK4_Mmus        --------RPEITNWVRLTHE---IK---H-KN-IVTFHEWY-----ETS---NH-LWLV
Apg1_Ddis        ----NSKLTENLNYEIRILKE---LS---H-TN-IVRLYDVL-----NEETDPTF-IYMI
CG10967_Dmel     -------TQNLLGKEIKILKELTELH---H-EN-VVALLDCK-----ESQ---DC-VSLV
CG8866_Dmel      ----T--SRENLITEIRLLRE---LK---H-KY-IVTLQDFF-----WDD---KN-IYIV
APG1_Scer        ----K-KLLENLEIEIAILKK---IK---H-PH-IVGLIDCE-----RTS---TD-FYLI
13031_Tthe       ------N-LQSALNELRIIEQ---LP--QN-KN-LVSFEKIKF----NTQ---ED-MYFI
9755_Tthe        ------NMQISIEKEKSVLEK---LP--YC-IN-LVNYQKFCL----ESN---NN-YYFV
DDB0230007_Ddis  -----------------------------------------------ENL---ST-YYLV
CC1G_15592_Ccin  ------RLLDNLQSEIQILKS---LS---H-RH-ITKLIDIV-----RAE---KN-IYLI
AqueK210_Aque    ------------------------------------------------------------
AqueK211_Aque    ------------------------------------------------------------
AqueK212_Aque    ----A--SAENLFTEIKVMKG---ID---H-KH-IVRMLDFE-----WNS---EH-IFIM
AqueK213_Aque    ------KLSTARQDEISILKD---LK---H-PN-IVQLYHYE-----EMS---NE-IYLI
AqueK214_Aque    ------------------------LD---H-TH-ILQFLEWY-----RSP---QH-IWLV
AqueK215_Aque    ------KAEQNLMREIDVLKK---LR---QCEY-VVHLYHVQ---DMQRA---DA-IVMV
ULK_a_Smoe       ------QQLELIAQEQAIMKS---I---AH-PN-VVKLLGMISEDEHDEL---ST-RYLV
ULK_c_Smoe       ------KLQESLLSEISILKK---AN---H-PN-IIRLHAIV-----EAP---DR-IYLI
ULK_d_Smoe       ------KLQESLLSEISILKK---AN---H-PN-IIRLHDIV-----EAP---DR-IYLI
ULK_b_Smoe       -------QLELIAQEQAIMKS---I---AH-PN-VVKLLGMISEDEHDEL---ST-KYLV
GK070_Glam       ------ALKTKVQVEATFLSS---NV---H-PN-ILRFISWY-----QSN---DE-IWLI


2332_Tthe        LEYCNQGTLLSYISKK-------KP--------------------------K---VEECV
9454_Tthe        SEYCNGGDLQQYIESR-------PY--------------------------IS--EAECL
16220_Tthe       MEKCEGGNLQKYIEDS-SKQ-ANKQ--------------------------LT--QYQIL
19068_Tthe       MEYCEQGTLDSYLKLY---E--GGV--------------------------LH--EKKAL
22937_Tthe       MEYCESNLLDYVYHKK------NHI--------------------------LE--EKEAV
26140_Tthe       LELCEGGTLSDLMKKF---H--NHC--------------------------IP--EKIAL
28647_Tthe       TEFYEGQSLFSFIRSQ---P--DKK--------------------------IQ--HQQAL
5444_Tthe        LEYCQYGSLEEYLRKN---S--FKF--------------------------IS--ERFLK
8897_Tthe        MEYCDQGDLRDYQCTK---M--HCI--------------------------FN--EDEAL
ULK3_Hsap        MEFCAGGDLSRFIHTR-------RI--------------------------LP--EKVAR
ULK2_Hsap        MEYCNGGDLADYLQAK-------GT--------------------------LS--EDTIR
ULK1_Hsap        MEYCNGGDLADYLHAM-------RT--------------------------LS--EDTIR
ULK4_Hsap        VELCTGGSLKTVIAQD---E----N--------------------------LP--EDVVR
T07F12.4_Cele    MELCDC-DLDHHMRNI--SV--KGR--------------------------LN--PSNFR
unc-51_Cele      MEFCNGGDLADYLQQK-------TT--------------------------LN--EDTIQ
1348_Tthe        MEYCEGGDLELLKKK-------INR--------------------------VD--EKQAV
1349_Tthe        LEYCNGGDLDKLIKR-------QGR--------------------------LS--EVETI
1429_Tthe        QEYCDGGDFRSELKKR-------KN--------------------------LS--EQESL
1439_Tthe        LDYCNAGNLKQQIQK-------EKK--------------------------FS--ENKAK
2103_Tthe        TELCELGDLEVFIKNNFSAT--KLR--------------------------LP--EELVK
2836_Tthe        MDYCNGGTLTQYLKNQ-------KK--------------------------IS--ENEIL
3032_Tthe        LEYCMDGDLKEYLKKK---K--GGM--------------------------LS--EPEAI
3104_Tthe        YEYCNGGTLEDIINNQ-------KT--------------------------LP--EHEAL
3833_Tthe        MEFCQHGDLEQFFNRK-KESPNPKK--------------------------LT--ELEIR
4111_Tthe        LEYCVDGDLKSYLKKK---E--NKI--------------------------LS--EPEAI
5362_Tthe        LELCPEGDLNNLLKSK---G---GS--------------------------LN--EQEAI
5380_Tthe        FEYCELGDLEQYMKEK---F--NGK--------------------------FP--LSIAL
5688_Tthe        LELCPDGDLRKFIHSN---G---GH--------------------------LN--ETLSL
6347_Tthe        MEYCNGGTLEKYIQQK-------KL--------------------------IS--EKEAK
6347~b_Tthe      SEYLKYGNLQTINSTN-K------K--------------------------FL--QQEIL
6603_Tthe        LEYCNEGDLMQYQKEK-------KY--------------------------LT--EDEAI
7377_Tthe        MEYCEGGDLKHYIEKK---G---GK--------------------------LK--EKQAI
8181_Tthe        LEYCADGDLKKLLEKR---G---GK--------------------------LP--ESEAV
8636_Tthe        YEFCSGGTLEDQLKKK-------KI--------------------------FK--ENEAL
8696_Tthe        LEYCHDGDLKEYLKKK---E--GKR--------------------------LS--EPEAL
9457_Tthe        LEYCDGGDLEKYLKEK-------QF--------------------------IT--ESECL
10447_Tthe       LEYCNQGDLGQLLTRK-KDK--KEN--------------------------IS--EQEVI
11042_Tthe       LEYCDGGDILSLMKKN---E--GKR--------------------------FS--EEIAI
11253_Tthe       YEFCNGGTLEDIIKKK-------KF--------------------------LN--EKEAL
11660_Tthe       AEYCPQGTLKKYIQEK-K------P---------------------------S--LQRIM
13838_Tthe       MEYCEGGDLEKYLQKN-------GP--------------------------IP--EQKAI
14572_Tthe       TEFCQDGDLRQFMKSN-------KN--------------------------LS--EDVIT
15010_Tthe       FEFCSNGDLENYIKKH---Y--EGK--------------------------IS--ETLCQ
15044_Tthe       QEYCDGGDLEQYVKKY-------KY--------------------------LP--EAQAI
15069_Tthe       MEYCNQGTLFNYILKN-------KP--------------------------E---ETECV
15675_Tthe       LDYCNGGDLSKYIDNK---P--QKR--------------------------LT--ESEAL
15705_Tthe       LDYCNGGDLRQYIVKK------KNR--------------------------LA--EEEAV
15762_Tthe       MEYCAEGNLFNLLHSK---N--GQG--------------------------LP--ENEAL
15836_Tthe       TEYCNQGDLGTLLVKH-------KR--------------------------FP--EQRVI
15837_Tthe       LEYCDSGDLEQYLKKR-------RT--------------------------IP--EPEAI
16588_Tthe       LEYCNGGNLQSILKHN---Q---GS--------------------------LS--ESQAV
18315_Tthe       FEYSSGGNLLSLIEQD---K----K--------------------------LT--EPQIK
18701_Tthe       QEFCDQGDFRNYLKQK-------GY--------------------------LP--EQEAK
18780_Tthe       TELCEFGDLDSFVNRF---E--NRT--------------------------LP--EDVAK
19558_Tthe       QEFCQDGELKHYIQTI-QKS--NMP--------------------------FDEYEKICL
19707_Tthe       YEYCNGGTLEQAIHRK-------KF--------------------------LS--EGETI
20769_Tthe       TEFCKDKDLRFLIQ-N-------KR--------------------------LT--ENQAL
20902_Tthe       VEFCNQGNLDKYIKQ----K----N--------------------------LS--EEKCI
21109_Tthe       LEYIKDGDLSKYLEN-------KRR--------------------------LS--QEETV
21913_Tthe       FEYCPGGDLQTLIEQD---K----K--------------------------LP--EQLVK
22048_Tthe       MRHYQKGDLDHYLQEN-R-----LK--------------------------LS--EKDIL
22049_Tthe       TQFCNQGNLQEFINKN-Q-----KI--------------------------IN--EGFLL
24363_Tthe       IEYCGDGDLRGLLEKN---N---YN--------------------------IS--ESQAI
24887_Tthe       TELCEDGDLVDFMKRN---A---GK--------------------------IR--QNQAV
24896_Tthe       TEFCNQGDLRTYLKKK-------KS--------------------------LT--EREAI
26436_Tthe       YEFLQGRNLKKLLNER---H----H--------------------------LS--EMEAV
26742_Tthe       TEFCDHGDLKELITKY-------GT--------------------------FS--EKPAV
27664_Tthe       VEYCNGGSLESYLNKN---G---KR--------------------------LS--ETETL
28079_Tthe       VEYVDGFTLKKKLEQL-QLE--GKT--------------------------FS--ENTTI
28933_Tthe       TEICNQGDLRDLLKKY-------NT--------------------------LE--ESQAV
29387_Tthe       SEYCPEGTLKDYFKKE-I------S--------------------------PS--INDIM
30213_Tthe       LEFCEGGDLSQYVKKN-------GP--------------------------LP--EQKAI
ULK3_Spur        MEFCSGGDLSQTIHKR-------IA--------------------------LP--EATVK
ULK1_Spur        MEFCNGGDLADYLHIK-------GT--------------------------LS--EDTIR
ULK4_Spur        VELCTGGSLELILSQD---G----H--------------------------FP--ETAVR
ULK1_Mmus        MEYCNGGDLADYLHTM-------RT--------------------------LS--EDTVR
ULK2_Mmus        MEYCNGGDLADYLQAK-------GT--------------------------LS--EDTIR
ULK3_Mmus        MEFCAGGDLSRFIHTR-------RI--------------------------LP--EKVAR
ULK4_Mmus        VELCTGGSLETVIAQD---E----N--------------------------LP--EDVVR
Apg1_Ddis        MECCEGGDFSKYIRTH-------KK--------------------------LT--EEKAL
CG10967_Dmel     MEYCNGGDLADYLSVK-------GT--------------------------LS--EDTVR
CG8866_Dmel      LEYCNAGNLSAFIRTK-------KA--------------------------LP--ESTCR
APG1_Scer        MEYCALGDLTFLLKRR-------KELMENHPLLR--TVFEKYPPPSENHNGLH--RAFVL
13031_Tthe       MEYCEGGNLQDYIYNN-------DY--------------------------LS--EIEIQ
9755_Tthe        MEYCNGGSLQDLLFKD------FKI--------------------------LS--EQEII
DDB0230007_Ddis  KRISFEYSFKEFLNSD---Q----Y--------------------------LS--IDTSI
CC1G_15592_Ccin  MEYCAGGDLTNYIKKR-------GRVEGLEYIPAPGEPPQYY--PHPRSGGLD--EIVLR
AqueK210_Aque    LDYCGGGDLFHFISSC-------KN--------------------------LK--ESLAR
AqueK211_Aque    ------------------------------------------------------------
AqueK212_Aque    LDYCGGGDLSHFISSR-------KT--------------------------LK--ESLAR
AqueK213_Aque    MEFCNGGDLAEYLQKM-------KT--------------------------LS--EESIR
AqueK214_Aque    TELASVGTLADLMSAD---G----P--------------------------VP--LESIP
AqueK215_Aque    MELCE-CDLDHLIKVK--------P--------------------------FC--DQDVT
ULK_a_Smoe       MEFCEGGDLDHYIHLN-------KK--------------------------LS--AGVAR
ULK_c_Smoe       LEYCAGGDLAGYIHRH-------GK--------------------------VG--ESAAR
ULK_d_Smoe       LEYCAGGDLAGYIHRH-------GK--------------------------VG--ESAAR
ULK_b_Smoe       MEFCEGGDLDHYIHLN-------KK--------------------------VS--AGVAR
GK070_Glam       TELCEGGSLESLLSRE---Y---HY--------------------------WP--EVSVE


2332_Tthe        DLFIQILAGV-KHIHEKGILHRDLKPENMFLH------------------------DGVL
9454_Tthe        DLFKQIVSAL-QVLDKNNIAHRDLKPANILLNK------------------------GQV
16220_Tthe       DLFYKIVKGYKESLYENNIIHRDLKPENIMIHEGN------------------------P
19068_Tthe       NMFAYILQGI-RAIHEAGFIHRDLKGSNILMQ------------------------NGLP
22937_Tthe       DLFLQILNGF-QSIHEKGIIHRDLKLENVLIQ------------------------DGII
26140_Tthe       NLFVQILVGF-KEIQKANLIHRDVKLQNILLKN------------------------DQP
28647_Tthe       VIFRYILSGL-IELHELNILHRNIKVENIILTN-----------------------DQSV
5444_Tthe        DYFKQILFGL-QELHSKRILHRDIKLSNILVKNA-----------------------KEF
8897_Tthe        SIFAQILQGF-KSIHEKGFIHRDLKERNILMK------------------------NNVA
ULK3_Hsap        VFMQQLASAL-QFLHERNISHLDLKPQNILLSSLE---------------------KPHL
ULK2_Hsap        VFLHQIAAAM-RILHSKGIIHRDLKPQNILLSYANRRK----S----------SVSGIRI
ULK1_Hsap        LFLQQIAGAM-RLLHSKGIIHRDLKPQNILLSNPAGRR----A----------NPNSIRV
ULK4_Hsap        EFGIDLISGL-HHLHKLGILFCDISPRKILLEGPG-----------------------TL
T07F12.4_Cele    LLLDNIARGY-KALYELKIVHRDIKPQNILITYTDAS-----------------KQIACA
unc-51_Cele      HFVVQIAHAL-EAINKKGIVHRDLKPQNILLCNNSRTQN---P----------HFTDIVI
1348_Tthe        ILFHQLIEGC-KYLYDKSVFHRDLKPANVLISDG------------------------VA
1349_Tthe        HYFKEIVDGC-DFLYKKAIIHRDLKPENILIHNG------------------------AA
1429_Tthe        NVMKDLLNGF-MDLLKNGIIHRDLKPENILIKGN------------------------QH
1439_Tthe        QIMIQIMSGL-KEMYQRSIVHRDIKPENILVAQTPQ--------------------GFVY
2103_Tthe        VFAYQILLAF-LGIADMNIIHRDMKLANVLITKD-----------------------FHL
2836_Tthe        EFLQQFCRGY-RVLYKEGIIHRDIKPDNILIHNR------------------------IF
3032_Tthe        KFFKHIVEGF-KELQKHQIIHRDIKPANIMLSG------------------------GRA
3104_Tthe        KIFKQLVAAF-TSIVKNNIMHRDLKPANILLHN------------------------GQV
3833_Tthe        FYFSQIIEAFK-YLRSKNLIHRDIKPQNILVKNDV------------------------W
4111_Tthe        KIFKHIVEGF-KELNKYKIIHRDIKPANLLISN------------------------GIV
5362_Tthe        NILCQLLLGF-KKMVEQGYIHRDIKPANILIKD------------------------GFY
5380_Tthe        TFIQQLKSAF-QEIRRLKFVHRDLKLANILLTKD-----------------------LTV
5688_Tthe        EILNQLMFGF-KELVDHGFIHRDIKPENTLIKN------------------------KVY
6347_Tthe        GYLIQLLSGF-KDLHSHLVIHRDIKLENIMRHFPNGQTGNDTY----------DNKNVVL
6347~b_Tthe      LLLINILIS-LKWLHENGIIHRNINLKSIYIAKLNESI----------------NFITQF
6603_Tthe        EFLIQILNAF-KTLVKNKIMHRDFKLANILKHNG------------------------NI
7377_Tthe        DILKQFMNGF-KEMHEKGYIHRDIKPQNILLSR------------------------ETF
8181_Tthe        QYFRQICEGF-KELYKNNIIHRDIKPANILLHK------------------------GVA
8636_Tthe        HVFAQLLEAF-KVLRKFNIMHRDLKPTNILLHN------------------------NQI
8696_Tthe        IFFRHIVEGF-KELQKHKIIHRDIKPANIMLSN------------------------GIA
9457_Tthe        DLFKQIVSAF-QMLEKKNIVHRDLKPANILLKN------------------------GQL
10447_Tthe       GYFKQILSGL-QELHKHLVVHRDLKLDNILISQ------------------------NCL
11042_Tthe       KHFRQITEAF-KMLHSKGIIHRDIKPANILLHK------------------------GIA
11253_Tthe       VIFQQILNAF-KSLFKENILHRDLKPSNILLHD------------------------GII
11660_Tthe       IIFCQIVKGYYTSLYIENIIHRDIKLDNILMKDDI------------------------P
13838_Tthe       GFLMQVLAGL-REIHSHSIIHRDLKPQNIFIK------------------------GNQL
14572_Tthe       QIFKQILEGI-RELHKVGVIHRDLKPANILIHN------------------------NEF
15010_Tthe       QVIFQVREAF-KELTKHKIVHRDLKLANILVDEE-----------------------FTI
15044_Tthe       SYLKQLLQAF-KELHFHKCMHRDIKPSNILISQ------------------------GLI
15069_Tthe       RIFVQILKGF-IEIHEKHILHRDLKPSNIFIK------------------------DGVF
15675_Tthe       EFFKQFVNGY-QHLYQSKIIHRDIKPENLMLHNG------------------------KI
15705_Tthe       EFFKQMCAGY-QALNEKKIIHRDLKPENILLHDN------------------------KI
15762_Tthe       VYFSQILNGL-KTIHEKGYMHRDLKPENILIH------------------------NNVA
15836_Tthe       SYFKQLLNGF-KDLHKHQVIHRDIKPENILINQ------------------------KTL
15837_Tthe       EFFKQILNGF-KGLHEVPAVHRDLKVANILIHNK-----------------------NIL
16588_Tthe       NIIYQITEGY-KCLLAKNMAHRDLKPANILFKD------------------------GIA
18315_Tthe       IFAKDLIQGL-LYLHSKGIIYCDLKPSNILLNEYG-----------------------TL
18701_Tthe       QVLVDILNGF-LELLKHGIIHRDLKPENILIQTKNPQ-----------------TGERIF
18780_Tthe       LFTNQILLGF-IALYDLDIIHRDMKLQNILINKN-----------------------FEC
19558_Tthe       EIAYQITQGMQ-TVHRMDIIHRDLKPQNILVHNKK------------------------I
19707_Tthe       KIFAQLLNAF-KAMIKENILHRDLKPSNILFHN------------------------NVI
20769_Tthe       HVLRDIVEGF-KELVKHNVIHRDLKPANILIND------------------------QVF
20902_Tthe       NIMFQIVEGF-KCLNQNNIVHRDLKPENILLHD------------------------KTV
21109_Tthe       FFFRQIVNGF-KELYKRNIIHRDIKPENILLEKKEN--------------------HKRL
21913_Tthe       SFSKDLAAGL-QYLHSKGIIYCDLKPSNILLNEFG-----------------------QL
22048_Tthe       TIFYKIIYGYFQNIYNRQIIHRDIKASNILMDELD------------------------P
22049_Tthe       NIFKMICVGYYEQIFSKNLIHRDIKPENILIHDGI------------------------P
24363_Tthe       SILQQILQGF-KSLIDQGYVHRDIKPENILINK------------------------NTF
24887_Tthe       KIITDILRGL-QELAKHGIIHRDLKPANILISKK-----------------------DVF
24896_Tthe       TVISQIMSGL-QELANNGIIHRDLKPANILIHD------------------------DVF
26436_Tthe       QIFQQICKGF-QRLQAEKIIKKNLNSHNVHIIEHQSENQ---------------QISYEV
26742_Tthe       KILKHLLNGL-DEMQNKGIIHRDLKLANILVKE------------------------GIP
27664_Tthe       RIIREIVSGF-KCLYEQKIVHRDLKPANILLHD------------------------GIP
28079_Tthe       SYFIQLLKGI-KDLHKNNIIHRDLKLENIMISKE-----------------------GII
28933_Tthe       KILKHIINGY-RELAKHRIVHRDIKPANILIND------------------------GIP
29387_Tthe       RIFLQIVKGYRQSIYSKGCIHRDIKLDNILMKDGK------------------------P
30213_Tthe       GFLMQILAGF-RVLHQNSIIHRDLKPANILMS------------------------GNVL
ULK3_Spur        TFLRQLASAL-MFLNSRNITHMDLKPQNLLLSNSY---------------------NPVL
ULK1_Spur        FFLGQIACAM-KAIHEKGIIHRDLKPQNLLLSHNSKHKV---P----------HPNEIHL
ULK4_Spur        GFGLDL----------------------ILVDSSG-----------------------SL
ULK1_Mmus        LFLQQIAGAM-RLLHSKGIIHRDLKPQNILLSNPGGRR----A----------NPSNIRV
ULK2_Mmus        VFLHQIAAAM-RILHSKGIIHRDLKPQNILLSYANRRK----S----------NVSGIRI
ULK3_Mmus        VFMQQLASAL-QFLHERNISHLDLKPQNILLSSLE---------------------KPHL
ULK4_Mmus        EFGVDLVTGL-HHLHRLGILFCDLSPGKILLEGPG-----------------------TL
Apg1_Ddis        YFMKQLANGL-KFLRQKQIVHRDLKPQNLLLSDDS--------------------EHPIL
CG10967_Dmel     LFLVQLAGAM-KALYTKGIVHRDLKPQNILLSHNYGKTL---P----------APSKITL
CG8866_Dmel      YFLRQLAAAV-QYMRANDVSHFDLKPQNLLLTRGA--------------------NNVSL
APG1_Scer        SYLQQLASAL-KFLRSKNLVHRDIKPQNLLLSTPLIGYH--DSKSFHELGFVGIYNLPIL
13031_Tthe       DFLYQFVSGY-ADLHSHNILHRDLKPENILIHKK------------------------QY
9755_Tthe        KFLVQFLNGY-KELLKNNIIHRDMKPQNIMIHND------------------------TY
DDB0230007_Ddis  IFSKNIMNAL-YYLHSNNIIYADLKPSNILIDSKG-----------------------IF
CC1G_15592_Ccin  SFLRQLARAL-KFLRHRDLIHRDIKPQNLLLNPAPPEEL---ARG-H------PLGVPIL
AqueK210_Aque    KFLRQLALAM-QFLRSKGIAHMDLKPQNLLLTEPP---------------------KTIL
AqueK211_Aque    ------------------------------------------------------------
AqueK212_Aque    KFLRQLALAM-QFLRSKGIAHMDLKPQNLLLTEPP---------------------KTIL
AqueK213_Aque    HLIKNISNAL-QVIHKRRIIHRDIKPQNLLLSYPPNKTP--AA----------SFQSATI
AqueK214_Aque    SFVSDILSGL-NHAHLMGVVIRDLCPAKIYLDACG-----------------------NL
AqueK215_Aque    VLLHQLGEGM-KALRAHNIVHRDIKPGNILIKYHPK------------------TGKMMI
ULK_a_Smoe       TIMLQLSAAL-QELRRMNLIHRDLKPHNLLLKNKVAPGS--DP----------EGEEIVV
ULK_c_Smoe       NIMQQLGSGL-QVLRKNNLIHRDLKPQNLLLSTND--------------------HNAVL
ULK_d_Smoe       NIMQQLGSGL-QVLRKNNLIHRDLKPQNLLLSTND--------------------HNAVL
ULK_b_Smoe       TIMLQLAAAL-QELRRMNLIHRDLKPHNLLLKNKV------------------------A
GK070_Glam       SFASDIRDAL-HFLHLKGITFNELLGSNILVDIDG-----------------------NI


2332_Tthe        KIADFGLAQF-EQ-----------------------------------------------
9454_Tthe        KIADFGYAKR-IQT----------------------------------------------
16220_Tthe       KITDFGMTLKYINPY---------------------------------------------
19068_Tthe       KISDFGLARK-AT-----------------------------------------------
22937_Tthe       KIADFGLAKK-LDNSPT-------------------------------------------
26140_Tthe       KIADFGLVTQ-QQ-----------------------------------------------
28647_Tthe       KICGFGICRE-LD-----------------------------------------------
5444_Tthe        KIADLGFCKK-LAED---------------------------------------------
8897_Tthe        KISDFGLAKQ-LS-----------------------------------------------
ULK3_Hsap        KLADFGFAQH-MSPW---------------------------------------------
ULK2_Hsap        KIADFGFARY-LHSN---------------------------------------------
ULK1_Hsap        KIADFGFARY-LQSN---------------------------------------------
ULK4_Hsap        KFSNFCLAKV-EGENLEEFFA-------------------LVAAEEGGG-----------
T07F12.4_Cele    RITDFGISRT-LDNE---------------------------------------------
unc-51_Cele      KLADFGFARF-LNDG---------------------------------------------
1348_Tthe        KIADFGFCKL-VEENK--------------------------------------------
1349_Tthe        KIADFGFAKV-IDYDNR-------------------------------------------
1429_Tthe        KLADFGFART-VDNFQR-------------------------------------------
1439_Tthe        KLADFGFAKI-LNNQ---------------------------------------------
2103_Tthe        KVADFGLAKS-SFE----------------------------------------------
2836_Tthe        KIADFGLAKI-VDTLQ--------------------------------------------
3032_Tthe        KISDFGFSRQ-LEVD---------------------------------------------
3104_Tthe        KLADFGFCKA-LQSP---------------------------------------------
3833_Tthe        KVADFGFAKK-TTS----------------------------------------------
4111_Tthe        KLADFGFSKV-VEDE---------------------------------------------
5362_Tthe        KVSDFGFATG-VDIK---------------------------------------------
5380_Tthe        KLGDFGFAKH-FDD----------------------------------------------
5688_Tthe        KVADFGFACK-ADIS---------------------------------------------
6347_Tthe        KIADLGLAKE-MK-----------------------------------------------
6347~b_Tthe      KLGGFKNCYK-FEQR---------------------------------------------
6603_Tthe        KIADFGFAKL-LGN--D-------------------------------------------
7377_Tthe        KIADFGFATK-VDPR---------------------------------------------
8181_Tthe        HITDFGFART-LDCSGM-------------------------------------------
8636_Tthe        KLADFGFCKS-LTNP---------------------------------------------
8696_Tthe        KISDFGFSRV-VEKD---------------------------------------------
9457_Tthe        KIADFGFAKE-IQD----------------------------------------------
10447_Tthe       KIADFGFAKS-FDNT---------------------------------------------
11042_Tthe       KISDFGFARM-LDQTNL-------------------------------------------
11253_Tthe       KVADFGFCKT-LLSP---------------------------------------------
11660_Tthe       KICDFGFGKF-LDDV---------------------------------------------
13838_Tthe       KIGDFGCART-AFID---------------------------------------------
14572_Tthe       KIADFGFARD-VDFQ---------------------------------------------
15010_Tthe       KIADFGFAKH-NQD----------------------------------------------
15044_Tthe       KLGDFGFAKQ-LND----------------------------------------------
15069_Tthe       KIADFGLAKP-KA-----------------------------------------------
15675_Tthe       KLGDFGFGRF-VEGNM--------------------------------------------
15705_Tthe       KIGDFGFARI-VNDL---------------------------------------------
15762_Tthe       KICDFGFARP-LG-----------------------------------------------
15836_Tthe       KIADLGFAKS-ITGT---------------------------------------------
15837_Tthe       KIADLGFGKI-IKD----------------------------------------------
16588_Tthe       KIADFGFSKV-VGLND--------------------------------------------
18315_Tthe       KYCDFGLARQ-IVDLIQT------------------------------------------
18701_Tthe       KLADFGFSRT-VDNFRR-------------------------------------------
18780_Tthe       KIADFGLAKS-CQE----------------------------------------------
19558_Tthe       KIIDFGFCKS-FDNQ---------------------------------------------
19707_Tthe       KIADFGFCKS-LMNP---------------------------------------------
20769_Tthe       KIADFGFAKY-VDYS---------------------------------------------
20902_Tthe       KIADFGFSKV-VEAGM--------------------------------------------
21109_Tthe       LISDFGFARV-VNQDQM-------------------------------------------
21913_Tthe       KICDFGLSRR-IIDMITA------------------------------------------
22048_Tthe       YITDFGLSIK-FQDL---------------------------------------------
22049_Tthe       LIADFGFAKH-LDDN---------------------------------------------
24363_Tthe       KIADFGFATK-IQDQ---------------------------------------------
24887_Tthe       KITDFGFARM-VEKT---------------------------------------------
24896_Tthe       KITDFGFAKK-LDSM---------------------------------------------
26436_Tthe       KLKHFFICKS-SSSNSSS------------------------------------------
26742_Tthe       KIADFGFSKD-LNAE---------------------------------------------
27664_Tthe       KIADFGFSKV-VEHSM--------------------------------------------
28079_Tthe       KIIDFGSSRE-LKE----------------------------------------------
28933_Tthe       KLADFGFAKD-IDAP---------------------------------------------
29387_Tthe       KICDFGFGKF-LDDV---------------------------------------------
30213_Tthe       KIADFGAART-VD-----------------------------------------------
ULK3_Spur        KVADFGFAQH-ITED---------------------------------------------
ULK1_Spur        KIADFGFARF-LEGD---------------------------------------------
ULK4_Spur        KYDDFSLARL-EEENLDDIFD-------------------MTS-----A-----------
ULK1_Mmus        KIADFGFARY-LQSN---------------------------------------------
ULK2_Mmus        KIADFGFARY-LHSN---------------------------------------------
ULK3_Mmus        KLADFGFAQH-MSPW---------------------------------------------
ULK4_Mmus        KFSNFCLAKV-AGESLEEFFA-------------------LVAAEEGGG-----------
Apg1_Ddis        KIGDFGFAKF-IDPF---------------------------------------------
CG10967_Dmel     KIADFGFARF-LNEG---------------------------------------------
CG8866_Dmel      KVADFGFAQH-LKLG---------------------------------------------
APG1_Scer        KIADFGFARF-LPNT---------------------------------------------
13031_Tthe       KIADFGLSTI-LEFKN--------------------------------------------
9755_Tthe        KICDFGQSKI-IENFD--------------------------------------------
DDB0230007_Ddis  KLNSINNSIL-IENNNNNNNNNNNNNNNNNNNNNNNQQIMITSRQQIFN-----------
CC1G_15592_Ccin  KVADFGFARS-LPNA---------------------------------------------
AqueK210_Aque    ------------------------------------------------------------
AqueK211_Aque    ------------------------------------------------------------
AqueK212_Aque    KIADFGMAQL-LKDN---------------------------------------------
AqueK213_Aque    KLADFGFARY-LNGA---------------------------------------------
AqueK214_Aque    KLSDFSLAID-LKKNKDDDDN-------------------INV-----MKDIEQFYSSII
AqueK215_Aque    KLADFGFARH-FKDESM-------------------------------------------
ULK_a_Smoe       KLTDFGLARK-LQPQG--------------------------------------------
ULK_c_Smoe       KIADFGFARS-LQPQ---------------------------------------------
ULK_d_Smoe       KIADFGFARS-LQPQ---------------------------------------------
ULK_b_Smoe       PGSD--------------------------------------------------------
GK070_Glam       KLADFEFASQ-IVKHQP-------------------------------------------


2332_Tthe        ------------------------------------------------------D-DF-V
9454_Tthe        ----------------------------------------------------GNI-KN-T
16220_Tthe       ----------------------------------------------------DMI-QF-S
19068_Tthe       ---------------------------------------------------TSQM-IQ-S
22937_Tthe       -------------------------------------------------STKEHL-AR-S
26140_Tthe       ---------------------------------------------------KD-K-VD-G
28647_Tthe       ---------------------------------------------------TDNM-TW-S
5444_Tthe        ----------------------------------------------------QNI-CQ-T
8897_Tthe        ---------------------------------------------------FNQL-TK-S
ULK3_Hsap        -----------------------------------------------------DE-KH-V
ULK2_Hsap        -----------------------------------------------------MM-AA-T
ULK1_Hsap        -----------------------------------------------------MM-AA-T
ULK4_Hsap        ---------DNGEN-----------------------------------VLKKSM-KS-R
T07F12.4_Cele    ----------------------------------------------------GEE-LC-N
unc-51_Cele      -----------------------------------------------------VM-AA-T
1348_Tthe        ---------------------------------------------------EKAM-FR-T
1349_Tthe        ---------------------------------------------------EKAA-TQ-T
1429_Tthe        -----------------------------------------------------QM-LT-S
1439_Tthe        -----------------------------------------------------DM-IK-S
2103_Tthe        ------------------------------------------------------K-DK-D
2836_Tthe        ---------------------------------------------------V--Q-NI-S
3032_Tthe        ----------------------------------------------------NQA-YM-T
3104_Tthe        ----------------------------------------------------QDL-SQ-T
3833_Tthe        ----------------------------------------------------NEL-T--D
4111_Tthe        ----------------------------------------------------EAR-LR-S
5362_Tthe        ---------------------------------------------------SQQL-LK-E
5380_Tthe        ----------------------------------------------------NSL-LQ-S
5688_Tthe        ---------------------------------------------------GKKL-IK-E
6347_Tthe        ---------------------------------------------------DEMI-AH-T
6347~b_Tthe      ---------------------------------------------------SSYA-KS-K
6603_Tthe        -----------------------------------------------------NL-TS-T
7377_Tthe        ---------------------------------------------------GKQF-MK-E
8181_Tthe        ---------------------------------------------------NNQL-KM-T
8636_Tthe        ----------------------------------------------------TDM-AQ-T
8696_Tthe        ----------------------------------------------------DPA-LL-S
9457_Tthe        -----------------------------------------------------DV-QN-T
10447_Tthe       ----------------------------------------------------KEV-TL-T
11042_Tthe       ---------------------------------------------------NSQQ-KL-T
11253_Tthe       ----------------------------------------------------QDL-TQ-T
11660_Tthe       ---------------------------------------------------ELSI-YQ-S
13838_Tthe       ---------------------------------------------------SLNV-GK-T
14572_Tthe       ---------------------------------------------------SEKL-LV-S
15010_Tthe       ----------------------------------------------------DDL-LK-S
15044_Tthe       ----------------------------------------------------QDI-TK-T
15069_Tthe       ------------------------------------------------------L-GS-S
15675_Tthe       ---------------------------------------------------NQQH-RM-S
15705_Tthe       ---------------------------------------------------DQAV-RM-T
15762_Tthe       ---------------------------------------------------FNEL-TT-T
15836_Tthe       --------------------------------------------------------TQ-T
15837_Tthe       ----------------------------------------------------NQL-GV-T
16588_Tthe       ---------------------------------------------------DTKL-RH-S
18315_Tthe       --------------------------------------------------DEDVK-EG-S
18701_Tthe       -----------------------------------------------------EL-LT-S
18780_Tthe       ------------------------------------------------------I-GH-T
19558_Tthe       ----------------------------------------------------AHM-IK-S
19707_Tthe       ----------------------------------------------------QDM-TS-T
20769_Tthe       ---------------------------------------------------SAQL-LR-S
20902_Tthe       ---------------------------------------------------DEPI-IT-S
21109_Tthe       ---------------------------------------------------NKQI-EQ-T
21913_Tthe       ---------------------------------------------------DEGK-ET-V
22048_Tthe       ---------------------------------------------------QKEV-NP-Y
22049_Tthe       ---------------------------------------------------EVQI-EQ-T
24363_Tthe       ---------------------------------------------------NAQV-LK-E
24887_Tthe       ----------------------------------------------------DYL-MT-S
24896_Tthe       ---------------------------------------------------EDQL-MD-S
26436_Tthe       ---------------------------------------------------SRKF-EQ-F
26742_Tthe       ----------------------------------------------------PCK-FY-Y
27664_Tthe       ---------------------------------------------------EQAD-LA-S
28079_Tthe       ----------------------------------------------------GFS-AN-T
28933_Tthe       ----------------------------------------------------PYK-YY-Y
29387_Tthe       ---------------------------------------------------NAQI-NQ-S
30213_Tthe       ---------------------------------------------------LENQ-AA-T
ULK3_Spur        -----------------------------------------------------IQ-AD-M
ULK1_Spur        -----------------------------------------------------MM-AA-T
ULK4_Spur        ---------EGTSDQTKQG---GEGTA--------------------TSTLVIIL-YL-L
ULK1_Mmus        -----------------------------------------------------MM-AA-T
ULK2_Mmus        -----------------------------------------------------TM-AA-T
ULK3_Mmus        -----------------------------------------------------DE-KH-V
ULK4_Mmus        ---------DSGEN-----------------------------------ALKKSM-KT-R
Apg1_Ddis        -----------------------------------------------------SL-SD-T
CG10967_Dmel     -----------------------------------------------------AM-AA-T
CG8866_Dmel      -----------------------------------------------------EI-NQ-Q
APG1_Scer        -----------------------------------------------------SL-AE-T
13031_Tthe       ------------------------------------------------------Q-KV-E
9755_Tthe        ---------------------------------------------------VEHL-QY-S
DDB0230007_Ddis  ----------LYNN-----------------------------------NIDNDN-NN-N
CC1G_15592_Ccin  -----------------------------------------------------MM-AE-T
AqueK210_Aque    ------------------------------------------------------------
AqueK211_Aque    -----------------------------------------------------------S
AqueK212_Aque    -----------------------------------------------------DH-GA-S
AqueK213_Aque    -----------------------------------------------------DM-AA-T
AqueK214_Aque    NINEKLLVQNNDADSTKSVDIPGVNSLTQQHSIQPPSNHKDSAHSPLLALNAHHF-SS-P
AqueK215_Aque    ---------------------------------------------------KPLD-LT-S
ULK_a_Smoe       ------------------------------------------------------M-AQ-T
ULK_c_Smoe       -----------------------------------------------------GM-AE-T
ULK_d_Smoe       -----------------------------------------------------GM-AE-T
ULK_b_Smoe       ------------------------------------------------------------
GK070_Glam       --------------------------------------------------LTIEVIDKHV


2332_Tthe        YCGTSFYMAPEV----L--------------------------E---R------R-QV-T
9454_Tthe        YVGSPIFMSPQA----L--------------------------N---G------G-NY-D
16220_Tthe       VAGTPKYAPPEA----K--------------------------S---S------D-KLGN
19068_Tthe       SSCTPSYAAPEV----L--------------------------Q---G------K-QY-G
22937_Tthe       FCGTKAYLAPEV----L--------------------------M---G------N-YY-D
26140_Tthe       FAGTPMYMAPEI----L--------------------------D---G------K-NY-D
28647_Tthe       LCGTPSYLAPEI----L--------------------------L---G------Q-PY-N
5444_Tthe        VLGTKMYMAPEL----L--------------------------K---M------E-KY-G
8897_Tthe        RCWTLPYAAPEI----L--------------------------Q---G------L-SY-N
ULK3_Hsap        LRGSPLYMAPEM----V--------------------------C---Q------R-QY-D
ULK2_Hsap        LCGSPMYMAPEV----I--------------------------M---S------Q-HY-D
ULK1_Hsap        LCGSPMYMAPEV----I--------------------------M---S------Q-HY-D
ULK4_Hsap        VKGSPVYTAPEV----V--------------------------R---G------A-DF-S
T07F12.4_Cele    VAGTFYYMAPEVGANLL--------------------------K---T------C-QY-D
unc-51_Cele      LCGSPMYMAPEV----I--------------------------M---S------M-QY-D
1348_Tthe        TVGTPYYMSPQI----L--------------------------S---S------A-EY-S
1349_Tthe        YVGTPYYMAPQI----I--------------------------N---G------E-EY-S
1429_Tthe        LVGTPLYMSPQI----L--------------------------M---H------E-KY-T
1439_Tthe        QVGTPLYMDPQI----L--------------------------L---G------K-PY-D
2103_Tthe        QVGTPMTMAPEV----L--------------------------N---N------L-GY-D
2836_Tthe        TRGTPLYIAPEL----V--------------------------K---K------E-KA-S
3032_Tthe        LLGSPLYMSPQI----L--------------------------E---G------T-KF-S
3104_Tthe        MVGSPIYMAPEI----L--------------------------T---G------H-DY-T
3833_Tthe        FYGTLATLAPQV----M--------------------------L----------Q-NY-N
4111_Tthe        FIGSPLYMAPEL----Q--------------------------E---Q------M-PF-S
5362_Tthe        CVGTPLFMAPQL----L--------------------------R---S------K-EY-S
5380_Tthe        YCGTPITMAPEI----L--------------------------K---R------E-KY-N
5688_Tthe        CVGTPLYMAPQL----L--------------------------E---N------T-PY-T
6347_Tthe        YAGTVLTMAPEI----L--------------------------K---Q------K-SY-G
6347~b_Tthe      YKGMNFYTAPEI--------------------------------LS-D------K-IY-T
6603_Tthe        MLGSPLNMAPEV----L--------------------------D---G------Q-DY-N
7377_Tthe        YVGTPLYMAPQL----L--------------------------E---N------M-PY-T
8181_Tthe        YLGTPLYMSPQI----L--------------------------A---E------E-YF-S
8636_Tthe        MLGSPLYMAPEI----L--------------------------R---G------Q-DY-C
8696_Tthe        RLGSPLYMTPQI----L--------------------------D---G------V-PF-N
9457_Tthe        IVGSPIFMCPQA----L--------------------------D---G------TGHY-D
10447_Tthe       TLGTQTNMAPEV----L--------------------------E---E------K-PY-G
11042_Tthe       ALGSPLYMSPQI----L--------------------------S---Q------E-QF-S
11253_Tthe       MVGSPIYMAPEI----L--------------------------K---G------N-NY-N
11660_Tthe       KKCSPLYGAPQI----T--------------------------HKAE-------S-KY-S
13838_Tthe       TVGSSYFKAPEI----I--------------------------E---G------L-EY-G
14572_Tthe       CVGSPMYMDPLI----L--------------------------S---R------K-PY-G
15010_Tthe       TLGTPITMAPEI----L--------------------------N---G------K-QY-N
15044_Tthe       ALGTTITMAPEV----F--------------------------Y---Q------Q-EY-S
15069_Tthe       YCGTSYFMAPEI----L--------------------------Q---K------K-LH-D
15675_Tthe       IKCTPIYASPQL----L--------------------------L---K------E-IY-S
15705_Tthe       QKCSPLYAPPQI----L--------------------------L---N------E-KY-S
15762_Tthe       VCGTAEYMPPEL----H--------------------------Q---Q------Q-PY-D
15836_Tthe       CLGTYTTMAPEV----L--------------------------E---Q------K-PY-G
15837_Tthe       VLGTSLTMAPEV----L--------------------------E---N------K-KY-G
16588_Tthe       ILGSPQYMSPQL----L--------------------------S---Q------Q-EY-C
18315_Tthe       KKGTPYYMAPEL----F--------------------------Q---D------DGVY-S
18701_Tthe       LVGTPLYMSPQI----L--------------------------M---F------K-KY-T
18780_Tthe       YAGTPLTMAPEV----L--------------------------F---G------L-EY-N
19558_Tthe       AVGSPYYMSPQI----L--------------------------S---K------I-PY-T
19707_Tthe       MVGSPIYMAPEV----L--------------------------K---G------M-PY-N
20769_Tthe       CVGSPLYMAPQI----L--------------------------A---R------K-AY-G
20902_Tthe       FVGTPLYMSPQI----L--------------------------Q---K------Q-NY-S
21109_Tthe       PVGSLKYMAPQI----L--------------------------G---I------I-NF-S
21913_Tthe       KKGSPCYMAPEL----F--------------------------Q---D------DGVY-S
22048_Tthe       FKGTLFYSSPQI----Q--------------------------GLE-G------S-IY-S
22049_Tthe       YKCTPMYASPQI----Y--------------------------ILEEK------C-TY-S
24363_Tthe       CVGSPLYMSPQL----L--------------------------Q---Q------K-PY-S
24887_Tthe       LVGTPLYMSPQI----L--------------------------K---R------Q-MY-T
24896_Tthe       LVGTPLYMAPQI----L--------------------------N---K------Q-QY-T
26436_Tthe       LNEKFHYVAPEL----L--------------------------V---N------SQAD-S
26742_Tthe       NVGTPMYMCPQS----L--------------------------T---K------N-EY-S
27664_Tthe       LVGSPIYMCPQI----L--------------------------N---C------Q-TY-S
28079_Tthe       LVGTPYNMAPEV----W--------------------------F---Q------Q-DY-G
28933_Tthe       NVGTPMYMCPQ-------------------------------------------------
29387_Tthe       YKCTPLYGSPQI----T--------------------------HVQGV------I-KY-S
30213_Tthe       KIGTPLFLAPEI----Q--------------------------E---D------K-EY-G
ULK3_Spur        LRGSPLYMAPEI----I--------------------------T---D------R-IY-N
ULK1_Spur        LCGSPLYMAPEV----I--------------------------T---S------Q-HY-D
ULK4_Spur        IVGCPNYLAPEV----L--------------------------Q---G------Q-PH-S
ULK1_Mmus        LCGSPMYMAPEV----I--------------------------M---S------Q-HY-D
ULK2_Mmus        LCGSPMYMAPEV----I--------------------------M---S------Q-HY-D
ULK3_Mmus        LRGSPLYMAPEM----V--------------------------C---R------R-QY-D
ULK4_Mmus        VRGSLIYAAPEI----V--------------------------K---G------T-EF-S
Apg1_Ddis        FCGSPLYMAPEI----L--------------------------H---R------K-NY-T
CG10967_Dmel     LCGSPMYMAPEV----I--------------------------M---S------L-QY-D
CG8866_Dmel      LKGSPLYMAPEI----V--------------------------R---K------H-QY-D
APG1_Scer        LCGSPLYMAPEI----L--------------------------N---Y------Q-KY-N
13031_Tthe       GLGNLLTRAPEL----YPMHLRDQMFKDNKDYSKVIRLSYYILL---N------Y-IT-N
9755_Tthe        TMNSPFYQFENL----M--------------------------Q---D------S-QL-T
DDB0230007_Ddis  INESIYYLSPEV----L--------------------------K---G------Y-TY-S
CC1G_15592_Ccin  LCGSPLYMAPEI----L--------------------------R---Y------E-KY-D
AqueK210_Aque    ------------------------------------------------------------
AqueK211_Aque    FRGSPLYMAPEV----M--------------------------L---G------K-TY-D
AqueK212_Aque    FRGSPLYMAPEV----M--------------------------L---G------K-TY-D
AqueK213_Aque    LCGSPLYMAPEI----L--------------------------L---G------H-RY-D
AqueK214_Aque    SLPSPFYLSPES----I--------------------------E---H------S-LF-S
AqueK215_Aque    LAGTPVFMAPEA----L--------------------------R---CVFNPGVE-HY-D
ULK_a_Smoe       MCGTYLYMAPEV----I--------------------------S---H------N-KY-D
ULK_c_Smoe       LCGSPLYMAPEI----L--------------------------H---C------Q-KY-D
ULK_d_Smoe       LCGSPLYMAPEI----L--------------------------H---C------Q-KY-D
ULK_b_Smoe       ---------PEG-------------------------------E---A------I-VY-D
GK070_Glam       KSNGYLHKAPET----L--------------------------L--PD------G-SH-S


2332_Tthe        -YKSDLWSLGIVLFYMIF-R-RL--PFYSKQ--------------N------L-LKI---
9454_Tthe        LKKADVWSAGVCLYYMLF-K-KY--PFESQKE----------DLEE------L-KQV---
16220_Tthe       -YIFDIYSLGCILYFCLY-S-NT--PQSPT------------TYNQ------L-NEFHEC
19068_Tthe       -YKVDIWSLGVILYRIIF-G-CL--PFEGSS------------HTK------L-LKK---
22937_Tthe       -YKVDIWSLGVLLFVMLF-F-QF--PFGSRQD---------N-PSE------L-LKA---
26140_Tthe       -QQVDIWSLGVLLYAMMF-N-DF--PICEQT------------TYM------QLE-R---
28647_Tthe       -YKSDIWSLGVLLFAMVT-G-QL--PFGSNS------------SKK------AVYQK---
5444_Tthe        I-EAELFSVGVLFYLLSQ-G-RF--PFEANS------------PPQ------L-LKA---
8897_Tthe        -YKVDIWSLGVILFRMLF-N-SF--PFGCYS------------SDV------VQLQA---
ULK3_Hsap        -ARVDLWSMGVILYEALF-G-QP--PFASR------------SFSE------L-EEK---
ULK2_Hsap        -AKADLWSIGTVIYQCLV-G-KP--PFQAN------------SPQD------L-RMF---
ULK1_Hsap        -GKADLWSIGTIVYQCLT-G-KA--PFQAS------------SPQD------L-RLF---
ULK4_Hsap        -ISSDLWSLGCLLYEMFS-G-KP--PFFS------------ESISE------L-TEK---
T07F12.4_Cele    -SKVDMWSIGCLLYQCVT-G-EV--PFDECSL------------CK------L-FLY---
unc-51_Cele      -AKADLWSIGTILFQCLT-G-KA--PFVAQ------------TPPQ------L-KAY---
1348_Tthe        -IKCDVWSLGVMFYEILT-G-SL--PWLVPAK---------SSTQE------L-LDK---
1349_Tthe        -IKCDIWSLGVMLYQALY-G-MV--PFSD--K---------TSLES------L-AQK---
1429_Tthe        -AKSDLWSLAFIFYEMLY-G-KT--PYTAN------------SQYQ------L-VKN---
1439_Tthe        -SKCDIWSVGIIFYELLY-G-CT--PWPR--V---------TSQYD------L-LEK---
2103_Tthe        -SRCDVWSVGCMIYEMLE-G-RA--PFLPTNN---------GGIEE------L-KRL---
2836_Tthe        -SKVDMWSLGVILFRMLFKG-QY--PFLDPLIK--------YDVPT------A-LKH---
3032_Tthe        -SKCDVWSVGLVFYEMLY-G-KT--PWMGT------------SQIN------L-FNN---
3104_Tthe        -MKADIWSLGCVLYEMLY-G-EC--PYEES------------TIAK------L-ISA---
3833_Tthe        -HKCDIYSLGATLYWILY-N-QF--PYKET------------NQKR------L-LEQ---
4111_Tthe        -SKCDVWSTGIVLYEMLY-G-KT--PWNGS------------SQLN------L-FEN---
5362_Tthe        -SKSDIWSIGMMYYLMLF-G-KT--PWPAR------------DLNS------F-ITN---
5380_Tthe        E-KCDIWSLGIIIYQMIY-G-RP--PFNPHKG---------AHIQD