Protein (view, download) , Domain (view, download)
TESK2_Hsap_TESK           MDRSKRNSI-AG-FPP--R-----------------------------------------
TESK1_Hsap_TESK           MAGERP-PL-RG-PGP-GP-----------------------------------------
LIMK2_Hsap_LIMK           MGSYLSVP----------------------------------------------AYFTSR
LIMK1_Hsap_LIMK           MRLTLLCCTWRE-ERMG--------E-EGSELPVCASCGQRI---YDGQYLQALNADWHA
LIMK1_Dmel_LIMK           MHHQQRLRA-NG-GRGGTGLGAGSGPVSGGHSPLCAHCRGQLLPHPEEPIVMALGQQWHC
cdi_Dmel_TESK             MSLNQHSG--PG-PPS--EIC---------------------------------------
LIMK2_Mmus_LIMK           MGSYLSVP----------------------------------------------AYFTSR
LIMK1_Mmus_LIMK           MRLTLLCCTWRE-ERMG--------E-EGSELPVCASCGQRI---YDGQYLQALNADWHA
TESK1_Mmus_TESK           MAGERP-PL-RG-PGP--------------------------------------------
TESK2_Mmus_TESK           MDRSKRNSI-AG-FPP--R-----------------------------------------
DDB0229851_Ddis_LISK-DD1  MSKLFQDS----------------------------------------------------
DDB0229853_Ddis_LISK-DD1  MNINFSKD----------DI----------------------------------------
DDB0229854_Ddis_LISK-DD1  MAEADP------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  MNVGVKVR----------EI----------------------------------------
DDB0229865_Ddis_LISK-DD1  MKIKDF------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  MISMDSTPT-LNFETS-DNL----------------------------------------
DDB0229867_Ddis_LISK-DD1  MVGG--------------------------------------------------------
KinX_Ddis_LISK-DD1        MGSVDTS-----------------------------------------------------
KinY_Ddis_LISK-DD1        MINGEQTMV-ED-ELP-D------------------------------------------
LIMK_Spur_LIMK            MSCADIFF--RS-Q----------------------------------------------
Tesk_Spur_TESK            MNIDEKLTA--K-Q----------------------------------------------
CC1G_09729_Ccin_LISK-DD1  MHSDA-------------------------------------------------------
AqueK481_Aque_LIMK        MGRMWH-----------------------------------------------------L
AqueK482_Aque_TESK        MVDSKFSA-----LPA--QLS---------------------------------------
AqueK483_Aque_TESK        MNFLRRVGR-SS-RSP-SPLTRGSG--------------NN-------------------
AqueK484_Aque_TESK        MTDGVDDTL-Q-------------------------------------------------
                          *

TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           DLFRCSECQDSLTNWYYEKDGKLYCPKDYWGK-------------------FGEFCHGCS
LIMK1_Hsap_LIMK           DCFRCCDCSASLSHQYYEKDGQLFCKKDYWAR-------------------YGESCHGCS
LIMK1_Dmel_LIMK           DCFRCSVCEGHLHNWYFEREGLLYCREDYYGR-------------------FGDACQQCM
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           DPFRCSECQESLTNWYYEKDGKLYCHKDYWAK-------------------FGEFCHGCS
LIMK1_Mmus_LIMK           DCFRCCECSVSLSHQYYEKDGQLFCKKDYWAR-------------------YGESCHGCS
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  -----------------------------------S------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        ECFRCTVCHVTLPECYYEEDGLSYCKDDFFKR-------------------LSHKCHQCS
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------SPTDDWSNTRSNTGNRSSSSSSGTANRKKEGKEERK
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           LLMT-GPFMVAG-EFKYHPECFACMSCKVIIEDGDAYALVQHATLYC-------------
LIMK1_Hsap_LIMK           EQITKGLVMVAG-ELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYC-------------
LIMK1_Dmel_LIMK           AVIT-GPVMVAG-EHKFHPECFCCTACGSFIGEGESYALVERSKLYC-------------
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           LLMT-GPAMVAG-EFKYHPECFACMSCKVIIEDGDAYALVQHATLYC-------------
LIMK1_Mmus_LIMK           EHITKGLVMVAG-ELKYHPECFICLACGNFIGDGDTYTLVEHSKLYC-------------
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ----------TG------------------------------------------------
DDB0229854_Ddis_LISK-DD1  -----------G------------------------------------------------
DDB0229863_Ddis_LISK-DD1  ----------TG------------------------------------------SIGVIE
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ----------DG------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ----------QG------------------------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        DYIT-GPTMAVGFSRMYHPECFHCTVCETTLGEKDIYCLLNTKDILC-------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        EHSTSGSNMIDGV--------------------DDNLQLTEAGCLVPDTPLSPSS-----
AqueK484_Aque_TESK        --------------------------------------LTEAGGLVPDMSLSP-S-----


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           ---------------------------------------------GKCHNE-VVLAPMFE
LIMK1_Hsap_LIMK           ---------------------------------------------GHCYYQ-TVVTPVIE
LIMK1_Dmel_LIMK           ---------------------------------------------GQCYGK-RSCQPADA
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           ---------------------------------------------GKCHNE-VVLAPMFE
LIMK1_Mmus_LIMK           ---------------------------------------------GQCYYQ-TVVTPVIE
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  KGNNQNGFFVNFGSRKNWKRNNEVEVIQNTIDNSNGKQSTTPKPIAQQQQQ-QQPPPQQS
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        ---------------------------------------------NDCSISDSCINGMIS
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           RLSTESVQEQLPYSVT-------------LISMPATT-----------------------
LIMK1_Hsap_LIMK           QILPDSPGSHLPHTVT-------------LVSIPASS-----------------------
LIMK1_Dmel_LIMK           KARITTAGKP-MHSIR-------------LVEIPKDA--T--------------------
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           RLSTESVQDQLPYSVT-------------LISMPATT-----------------------
LIMK1_Mmus_LIMK           QILPDSPGSHLPHTVT-------------LVSIPASA-----------------------
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  QQQPPQPL-------KPIPATRP------VPTIPKVQSEDPGPRFGNFTLPTTNSSTKYS
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            --------SHDPS-----------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        PVKTNSGR-TVYVSIQQIKVTLQRRVRFRLDGLPPAE-----------------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           --------------------------------EGRRGFSVS-VESA---------CSNYA
LIMK1_Hsap_LIMK           --------------------------------HGKRGLSVS-IDPP---HGPPGCGTEHS
LIMK1_Dmel_LIMK           --------------------------------PGLRVDGVA-LDD--------GC-----
cdi_Dmel_TESK             -----------------------------GLS--VDQVDSSAASPFIWPST-AGM-----
LIMK2_Mmus_LIMK           --------------------------------ECRRGFSVT-VESA---------SSNYA
LIMK1_Mmus_LIMK           --------------------------------HGKRGLSVS-IDPP---HGPPGCGTEHS
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------L-----
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------L-----
DDB0229863_Ddis_LISK-DD1  TLPSRQFFEVSSSPGDENGTFKRSAAPPPPSSLSSNQNGSNLNKVQSPSRP-S-I-----
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------L-----
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------L-----
KinX_Ddis_LISK-DD1        ------------------------------------------------------V-----
KinY_Ddis_LISK-DD1        ------------------------------------------------------K-----
LIMK_Spur_LIMK            -------------------------------------------------TGS--------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        --------------------------------GEKKRLSIKDFTPP---QL-PNPNQKTS
AqueK482_Aque_TESK        ----------------------------------SDSDD---------------------
AqueK483_Aque_TESK        --------------------------PVPPLSIKPHPLSS-SVSPP---NS-PGS-----
AqueK484_Aque_TESK        --------------------------PVPPISIEPHSLSS-SVSPP---DS-PGP-----


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           TTVQVKEVN-----------------RMHISPNNRNA---------------IHPGDRIL
LIMK1_Hsap_LIMK           HTVRVQGVD-----------------PGCMSPDVKNS---------------IHVGDRIL
LIMK1_Dmel_LIMK           PTVRITDLFCNFFLWLTSMAEQCCGAPYRI-DVNLTN---------------LHIGDRIL
cdi_Dmel_TESK             CTT-------------------------------------ATTVTTSTNGDAT-------
LIMK2_Mmus_LIMK           TTVQVKEVN-----------------RMHISPNNRNA---------------IHPGDRIL
LIMK1_Mmus_LIMK           HTVRVQGVD-----------------PGCMSPDVKNS---------------IHVGDRIL
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  P-----------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  P-----------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  P-----------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  P-----------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  P-----------------------------------------------------------
KinX_Ddis_LISK-DD1        P-----------------------------------------------------------
KinY_Ddis_LISK-DD1        P-----------------------------------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        YKKKVLKIE-----------------KLPRS-LIGTP---------------LKSGDIIM
AqueK482_Aque_TESK        ----------------------------------------------------S-------
AqueK483_Aque_TESK        PTVTISASE-----------------KLCKKPHPRSLDMRKLSIPTSVSLDCI-------
AqueK484_Aque_TESK        PTVTISASE-----------------KLCKKPHPQSLGMKKLSIPTSASLDCI-------


TESK2_Hsap_TESK           --------VERLEEFEGG------------------------------------------
TESK1_Hsap_TESK           --------GEVPGEGPPG------------------------------------------
LIMK2_Hsap_LIMK           EINGTPVRTLRVEE----VEDAISQTSQTLQLLIEHDPVSQR------------------
LIMK1_Hsap_LIMK           EINGTPIRNVPLDE----IDLLIQETSRLLQLTLEHDPHDTL------------------
LIMK1_Dmel_LIMK           EVNGTPVSDSSVEQ----IDKLIRSNEKMLQLTVEHDPVQVC------------------
cdi_Dmel_TESK             --AEAP--VKHQPLHNGG------------------------------------------
LIMK2_Mmus_LIMK           EINGTPVRTLRVEE----VEDAIKQTSQTLQLLIEHDPVPQR------------------
LIMK1_Mmus_LIMK           EINGTPIRNVPLDE----IDLLIQETSRLLQLTLEHDPHDSL------------------
TESK1_Mmus_TESK           --------GEAPGEG---------------------------------------------
TESK2_Mmus_TESK           --------VERLEEFEGG------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  -----------------SFEPPTQQPTQPLQKSPRNVPIVPKRTNPSPPSPPLQSPQPTP
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            ----------K-------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        EINEIPIINQNQEE----INNLMEVYDDCLYLMIERNSNQSH------------------
AqueK482_Aque_TESK        --DYSP------PNSRK-------------------------------------------
AqueK483_Aque_TESK        --KH--------------------------------------------------------
AqueK484_Aque_TESK        --NEYE--REKEEEYDSF------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           ------------------------------------------------------------
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  QQQPPPLKPIPQPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPLKPIPQPQQSQPTQ
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           --------------G---------------------------------------------
TESK1_Hsap_TESK           --------------P---------------------------------------------
LIMK2_Hsap_LIMK           --------------LDQLRLEARL-----APHMQNAGHPHALST-----------LD--T
LIMK1_Hsap_LIMK           --------------GHGLG-----------------PETSPLSSP----------AY--T
LIMK1_Dmel_LIMK           --------------RSCSQAD--I-----QRAMSASTLILPLSTSASSVEVGRERLY--K
cdi_Dmel_TESK             --------------W---------------------------------------------
LIMK2_Mmus_LIMK           --------------LDQLRLDARL-----PPHMQSTGHTLMLST-----------LD--T
LIMK1_Mmus_LIMK           --------------GHGPV-----------------SDPSPLSSP----------VH--T
TESK1_Mmus_TESK           --------------P---------------------------------------------
TESK2_Mmus_TESK           --------------G---------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  PIKSQIQIPITNTNG---------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            --------------------------------------------V----------MH--A
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        --------------DKGSS-NHLVSQNSTSSELDVTSEIHSVSSP----------AHHKP
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        -------------NG---------------------------------------------
AqueK484_Aque_TESK        -------------RV---------------------------------------------


TESK2_Hsap_TESK           -GG---EG----------------------------------------------------
TESK1_Hsap_TESK           -GG---TG----------------------------------------------------
LIMK2_Hsap_LIMK           KENLEG----------------------TLRRRSLRRS-N--------------------
LIMK1_Hsap_LIMK           PSGEAGS---------------------SARQKPVLRS-C--------------------
LIMK1_Dmel_LIMK           TPGEQGT---------------------KAR--KLRQA-TN-------------------
cdi_Dmel_TESK             -IG---NG----------------------------------------------------
LIMK2_Mmus_LIMK           KENQEG----------------------TLRRRSLRRS-N--------------------
LIMK1_Mmus_LIMK           PSGQAAS---------------------SARQKPVLRS-C--------------------
TESK1_Mmus_TESK           -GG---AG----------------------------------------------------
TESK2_Mmus_TESK           -GG---DG----------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  -NT---NG----------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            SSCNWGE---------------------RR------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        PLGEAADSNTLHVNGSLPAVPENSQSSQTSSYKPKLRPSLSSSGLSNPDYDLDLTKSLNV
AqueK482_Aque_TESK        ------GG----------------------------------------------------
AqueK483_Aque_TESK        -DY---DS----------------------------------------------------
AqueK484_Aque_TESK        -DS---DS----------------------------------------------------


TESK2_Hsap_TESK           --------N--VS-----------------------------------QVGR-VW-PSSY
TESK1_Hsap_TESK           --------G---------------------------------------GPGR-GR-PSSY
LIMK2_Hsap_LIMK           ---SISKSPGPSSP--K--------------------------EPLLFSRDI-SR-SESL
LIMK1_Hsap_LIMK           ---SIDRSPGAGSL--G--------------------------SPASQRKDL-GR-SESL
LIMK1_Dmel_LIMK           --ASTTIPPAAGAT--AMTQLKEKERCSSLSKLLDEQHQAQQHSAHPQLYDL-SR-TQSC
cdi_Dmel_TESK             -------LP--PAP--V---------------------------TRTISSDRLVT-GSSC
LIMK2_Mmus_LIMK           ---SISKSPGPSSP--K--------------------------EPLLLSRDI-SR-SESL
LIMK1_Mmus_LIMK           ---SIDTSPGTSSL--A--------------------------SPASQRKDL-GR-SESL
TESK1_Mmus_TESK           --------G---------------------------------------GPGR-GR-PSSY
TESK2_Mmus_TESK           --------N--TV-----------------------------------QVGR-VS-SSSY
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ----------------K--------------------------------STK--------
DDB0229854_Ddis_LISK-DD1  ----------------T-------------------------------------------
DDB0229863_Ddis_LISK-DD1  -------H---SSLVEK--------------------------------SPR-NNESTAT
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ----------------D-------------------------------------------
DDB0229867_Ddis_LISK-DD1  ----------------N-------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ----------------M-------------------------------------------
LIMK_Spur_LIMK            -----NNYPVMCSP--T--------------------------------SPL-SR-TQSY
Tesk_Spur_TESK            ------------------------------------------------------R-----
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        PSNPVPVSHGTAAI--P--------------------------VPRLVRS---RR-AQSV
AqueK482_Aque_TESK        -------TP------------------------------------------R-PK-SSSF
AqueK483_Aque_TESK        --------P--AH-----------------------------------HVPR-PS-SPLL
AqueK484_Aque_TESK        --------P--SH-----------------------------------HVPR-PS-S-AL


TESK2_Hsap_TESK           RA--LISAFSRLTRLDDF---TCEKIGSGFFSEVFKVRHRASGQVM--AL-KMNTLSS--
TESK1_Hsap_TESK           RA--LRSAVSSLARVDDFH--CAEKIGAGFFSEVYKVRHRQSGQVM--VL-KMNKLPS--
LIMK2_Hsap_LIMK           RC--SSSYSQQIFRPCDLI--HGEVLGKGFFGQAIKVTHKATGKVM--VMKELI-RCD--
LIMK1_Hsap_LIMK           RV--VC-RPHRIFRPSDLI--HGEVLGKGCFGQAIKVTHRETGEVM--VMKELI-RFD--
LIMK1_Dmel_LIMK           RV--VQ-KPQRIFRATDLV--IGEKLGEGFFGKVFKVTHRQSGEVM--VLKELH-RAD--
cdi_Dmel_TESK             RA--LRTAVSALYSVDDF---VKEKIGSGFFSEVYKVTHRTTGQVM--VL-KMNQLRA--
LIMK2_Mmus_LIMK           RC--SSSYSQQIFRPCDLI--HGEVLGKGFFGQAIKVTHKATGKVM--VMKELI-RCD--
LIMK1_Mmus_LIMK           RV--VC-RPHRIFRPSDLI--HGEVLGKGCFGQAIKVTHRETGEVM--VMKELI-RFD--
TESK1_Mmus_TESK           RA--LRSAVSSLARVDDFD--CAEKIGAGFFSEVYKVRHRQSGQVM--VL-KMNKLPS--
TESK2_Mmus_TESK           RA--IISAFSRLTSLDDF---TREKIGSGFFSEVFKVRHRASGQVM--AL-KMNTLSS--
DDB0229851_Ddis_LISK-DD1  ----NKRMSRI-VDYDEIKFDPLSIIGSGGFGKVYQGVLNGK-EIGI---KKITISDNDP
DDB0229853_Ddis_LISK-DD1  EE--DENDFSS-LDYSDL-F-MDVEIGRGSFGQVQKASYFGT-DVAV---KQLSTLVS--
DDB0229854_Ddis_LISK-DD1  -----Q-AIWD-IPFESLE--FNEKIGKGSFGSVFRGCYLGL-DVAI---KKIEKAD---
DDB0229863_Ddis_LISK-DD1  TA--TTKDMWN-IDYKELKF-VGNEIGSGKYGSVSLGYWLGT-PVAI---KKLHENNEE-
DDB0229865_Ddis_LISK-DD1  ----------N-IECDNLKIE-ENEFSKGSFAKVYKGSYYGN-PVCVKVIKKDTLIDKES
DDB0229866_Ddis_LISK-DD1  -----GSNAFK-INIDDLE--FGQEIGKGAYGKIFKGEYFGT-PVAI---KEISLQPNDV
DDB0229867_Ddis_LISK-DD1  ------SSLWN-IEYDDLV--FKDIIGKGNFGCVYRGNYLGV-EVAI---KQIPSF-DD-
KinX_Ddis_LISK-DD1        ----SFDRAWS-IKYEDLD--FISEIGSGGFGKVFKGEYLGA-PVAI---KKIHILPDDP
KinY_Ddis_LISK-DD1        -----SDESAD-IDIKDLK--VGESIGSGAYGIVYRGTLFNS-DVAI---KKIQNEKSE-
LIMK_Spur_LIMK            RV----SKNQRIFRPADLI--KGEVLGQGFFGKAVKVTHRYTGEVM--VIKELV-RYS--
Tesk_Spur_TESK            ------------------------------EESKTKIRHKADGRVM--VAKIGKQKIW--
CC1G_09729_Ccin_LISK-DD1  --------FDV-IPYEDIKG-DWKKLGSGSFGNVYKGSYLGI-DVAI---KEVLPSN---
AqueK481_Aque_LIMK        PVIDGRAGYTSCFRLHDLI--IGEVLGHGFYGNVIKVTHRYTEQVM--VMKEMR-NCT--
AqueK482_Aque_TESK        IA--LKDAVYQLTCLNDF---TREKIGQGFFAEVFKVTHKNTGEVM--VL-KLNKSRN--
AqueK483_Aque_TESK        SA--LREAVESVSNMEDFE--RIEKIGSGFFAEVYKVRHKLTDEIM--VL-KVNKGLT--
AqueK484_Aque_TESK        RA--LREAVGSVSNMEDFE--RIEKIGSGFFADVYKVRRKLTNQIM--VL-KVNKGLT--
                                                                      :

TESK2_Hsap_TESK           ----NRANMLKEVQLMNRL---SHPNILRFMGVCVH-------------Q-GQLHALTEY
TESK1_Hsap_TESK           ----NRGNTLREVQLMNRL---RHPNILRFMGVCVH-------------Q-GQLHALTEY
LIMK2_Hsap_LIMK           --EETQKTFLTEVKVMRSL---DHPNVLKFIGVLYK-------------DK-KLNLLTEY
LIMK1_Hsap_LIMK           --EETQRTFLKEVKVMRCL---EHPNVLKFIGVLYK-------------DK-RLNFITEY
LIMK1_Dmel_LIMK           --EEAQRNFIKEVAVLRLL---DHRHVLKFIGVLYK-------------DK-KLHMVTEY
cdi_Dmel_TESK             ----NRPNMLREVQLLNKL---SHANILSFMGVCVQ-------------E-GQLHALTEY
LIMK2_Mmus_LIMK           --EETQKTFLTEVKVMRSL---DHPNVLKFIGVLYK-------------DK-KLNLLTEY
LIMK1_Mmus_LIMK           --EETQRTFLKEVKVMRCL---EHPNVLKFIGVLYK-------------DK-RLNFITEY
TESK1_Mmus_TESK           ----NRSNTLREVQLMNRL---RHPNILRFMGVCVH-------------Q-GQLHALTEY
TESK2_Mmus_TESK           ----NRANLLKEMQLMNRL---SHPNILRFMGVCVH-------------Q-GQLHALTEY
DDB0229851_Ddis_LISK-DD1  NRDILLKFLEREIYTLKML---SHPNVIKFYGIAEK-------------E-RSLFLLTEL
DDB0229853_Ddis_LISK-DD1  IDPDYFKFMLREIKILKGM---RHPNIVQYIGACCH-------------E-GRYMIVTEY
DDB0229854_Ddis_LISK-DD1  -DPEYLKYIDREVSMLQSL---RHPFIVNFSGICVH-------------S-SGLYIVTEF
DDB0229863_Ddis_LISK-DD1  ----TEILVQRELQILKEI---RHPQIVQFLGVSRN-------------EKDEIHIITEF
DDB0229865_Ddis_LISK-DD1  -----WVFLKREIGILKNLLNQGHKNIIRFIGIGEK-------------D-SLLFLVTEL
DDB0229866_Ddis_LISK-DD1  KYKDLTKFIQREVAML-RF---SHPNLVQFIGVSER-------------G-SSLYIVTEF
DDB0229867_Ddis_LISK-DD1  --PDYCKYTEREVKALRYI---RHPFVVHFFGACKH-------------E-SGFYLITEF
KinX_Ddis_LISK-DD1        NRVDLEKFLNREIETIKLF---THPNVIQFVGISEN-------------N-GILFIVTEL
KinY_Ddis_LISK-DD1        -KNEFIKYLKREVAVLKNI---QHPNIVQFIGVYYEPLASPSLVNRLLNS-SSTWIVTEY
LIMK_Spur_LIMK            --DSAQRDFLKEVKVLRSL---DHYHVLKFIGVLYR-------------DK-RLNLVTEF
Tesk_Spur_TESK            --RANQHKMIQELELLNKL---QHPNVVRYMGACVK-------------DG-HIHPVLEY
CC1G_09729_Ccin_LISK-DD1  -DYDVAKYFEREWRLMKEC---RHPNICLFIGLSRAP----------PPD-NRIFIVSEF
AqueK481_Aque_LIMK        --EEAKKTFRKEVAVLKRL---HHPNLLKFIGILYQ-------------EDKLLTLITEF
AqueK482_Aque_TESK        ----NSKQMLAEIQLLNRL---SHSNILGFKGSCVH-------------E-GSLHALTEY
AqueK483_Aque_TESK        -----GTKTRQEVELLKRL---HHPNILHYIGSCIH-------------N-GQLHPLTEF
AqueK484_Aque_TESK        -----ATKTRQEVELLKRL---NHPNILHYIGSCIH-------------N-EQLHPLTEF
                                     *   :       *  :  : *                        : *

TESK2_Hsap_TESK           INSGNLEQLLDS-N----------------------------------LHLPWTVRVKLA
TESK1_Hsap_TESK           MNGGTLEQLLSS-P----------------------------------EPLSWPVRLHLA
LIMK2_Hsap_LIMK           IEGGTLKDFLRSM-----------------------------------DPFPWQQKVRFA
LIMK1_Hsap_LIMK           IKGGTLRGIIKSMD----------------------------------SQYPWSQRVSFA
LIMK1_Dmel_LIMK           VAGGCLKELIHDPA----------------------------------QVLPWPQRVRLA
cdi_Dmel_TESK             INGGSLEQLLANKE----------------------------------VVLSATQKIRLA
LIMK2_Mmus_LIMK           IEGGTLKDFLRSV-----------------------------------DPFPWQQKVRFA
LIMK1_Mmus_LIMK           IKGGTLRGIIKNMD----------------------------------SQYPWSQRVSFA
TESK1_Mmus_TESK           MNGGTLEQLLSS-P----------------------------------EPLSWPVRLHLA
TESK2_Mmus_TESK           INSGNLEQLLDS-D----------------------------------LYLPWTVRVKLA
DDB0229851_Ddis_LISK-DD1  VSGGDLHWYIKNKS----------------------------------IDITWKLKVKIA
DDB0229853_Ddis_LISK-DD1  IKGGDLHQFIKARG---------------------------------VSNISWTLRMKLA
DDB0229854_Ddis_LISK-DD1  VSGGDVRQLLKK-T----------------------------------PPIGWDKRVSIA
DDB0229863_Ddis_LISK-DD1  MDGGDLFDALIFGD----------------------------------IPLTWKEKLRIS
DDB0229865_Ddis_LISK-DD1  INGGDLGNILLDHK----------------------------------FHIPWSLRVKIA
DDB0229866_Ddis_LISK-DD1  VQGGDLAYYLFRNKFDDTPEQYIHRKVNVGSSSTPDLSDPTVHNGEKLVQLAWPLRIKIA
DDB0229867_Ddis_LISK-DD1  IEGLDLRRYLKSV----------------------------------PKPPKWLSRVNIA
KinX_Ddis_LISK-DD1        IEGGDLQYYLKNQS----------------------------------IDLPWFLRANIA
KinY_Ddis_LISK-DD1        IGGGNLHERIKDTK----------------------------------KDFPIELRIKLS
LIMK_Spur_LIMK            VGGGTLENIISDLD----------------------------------KPFPWLQRINAA
Tesk_Spur_TESK            VSGGCLTDILADES----------------------------------LALSWRQKGDLA
CC1G_09729_Ccin_LISK-DD1  IEGGNVRLYIHDKN----------------------------------KPFPWRLRMSFA
AqueK481_Aque_LIMK        IGGGTLRKRIKKKD----------------------------------VPFPWKLRIQIA
AqueK482_Aque_TESK        INGGTLEELLSS-D----------------------------------PHLSWSKRIKIA
AqueK483_Aque_TESK        VNGGTLKSLIQDVE---------------------------------KNPFPPEQRIQLS
AqueK484_Aque_TESK        VNGGTLKSLIQDVE---------------------------------KNPFPREQRIQLS
                          : .  :   :                                             :   :

TESK2_Hsap_TESK           YDIAVGLSYLHFKGIFHRDLTSKNCLIKRDEN-GYSAVVADFGLAEKIPDVS--------
TESK1_Hsap_TESK           LDIARGLRYLHSKGVFHRDLTSKNCLVRREDR-GFTAVVGDFGLAEKIPVYRE-------
LIMK2_Hsap_LIMK           KGIASGMAYLHSMCIIHRDLNSHNCLIKLDK----TVVVADFGLSRLIVEERKRA-----
LIMK1_Hsap_LIMK           KDIASGMAYLHSMNIIHRDLNSHNCLVRENK----NVVVADFGLARLMVDEKTQP-----
LIMK1_Dmel_LIMK           RDIACGMSYLHSMNIIHRDLNSMNCLVREDR----SVIVADFGLARSVDAPRLPSGNM-T
cdi_Dmel_TESK             LGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLAAKIPVK---------
LIMK2_Mmus_LIMK           KGISSGMAYLHSMCIIHRDLNSHNCLIKLDK----TVVVADFGLSRLIVEERKRP-----
LIMK1_Mmus_LIMK           KDIASGMAYLHSMNIIHRDLNSHNCLVRENR----NVVVADFGLARLMIDEKNQS-----
TESK1_Mmus_TESK           LDIAQGLRYLHAKGVFHRDLTSKNCLVRREDR-GFTAVVGDFGLAEKIPVYRE-------
TESK2_Mmus_TESK           YDIAVGLSYLHFKGIFHRDLTSKNCLIKRDEN-GYSAVVADFGLAEKIPDAS--------
DDB0229851_Ddis_LISK-DD1  RDIAASMAYLHENGVIHRDLKSTNLLVAEN----WVIKVCDMGLARKMDK----------
DDB0229853_Ddis_LISK-DD1  LDIASAFSYLHSKKVIFRDLKAKNILVDEIGDGLYRAKVIDFGFARIFDG----------
DDB0229854_Ddis_LISK-DD1  VDLAKAMVFLHAKKIIHRDLKSKNILLDEFQ----RIRLCDFGFARMSEQ----------
DDB0229863_Ddis_LISK-DD1  LDIAQSCRFLHARGILHRDLKSQNILLSTN----RRAKLCDLGLARMFEE----------
DDB0229865_Ddis_LISK-DD1  KDIAEGMEYLHSKQIMHRDLKSNNLLLGRN----WTIKICDFGFAKEITI----------
DDB0229866_Ddis_LISK-DD1  YDVACAMAYLHSRNVIHRDLKSTNLLVGDNW----RIKVCDMGFARTAQVGGG-------
DDB0229867_Ddis_LISK-DD1  LGVAKTFLFLHSKNLLHRDLKSKNILLDISR---NQIKLCDFGFARVGSQYSNGSDSSSS
KinX_Ddis_LISK-DD1        LDVSLAMSYLHSKSIVHRDLKSTNLLVDKN----WKIKVCDFGFARIVEE----------
KinY_Ddis_LISK-DD1        LDIALAMAYLHSRDIIFRDLKSKNILIDDSSS-PIRGKVCDFGFARILNKK---------
LIMK_Spur_LIMK            RDIASGMSYLHSMGIIHRDLNSNNCLVRDDG----SVVVADFGLARVFIDENDSRC----
Tesk_Spur_TESK            TDIARGMTYLHSQNVCHRDLTSANCLVRQKPNNVLEAILTDFGLARVLGCMPDPP-----
CC1G_09729_Ccin_LISK-DD1  TDVARALAYLHARKCIHRDLKGENLLVTSN----GRIKVTDFGFARIAARN---------
AqueK481_Aque_LIMK        LDISAGMN----------------------S----RAVVADFGLARVFYPLDFSN-----
AqueK482_Aque_TESK        HDIANGMAYLHNRGVFHRDLTSKNCLIQKSDDGSLNCVVADFGLAAKIV-----------
AqueK483_Aque_TESK        LDMAMGMEYLHNNGMLHRDFNSHNCLLRKEGD-RYTAVVADFGLATKNPNLIK-------
AqueK484_Aque_TESK        LDMALGMEYLHENGMLHRDFNSNNCLLRKEGD-RYTAVVADFGLAAKNPNLMK-------
                           .::                                  : *:*::

TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           --------------------------------PMEKATT-----------------KKRT
LIMK1_Hsap_LIMK           --------------------------------------E-----------------GLRS
LIMK1_Dmel_LIMK           P--------GG-Y-----------GSGANSDAPMSPSG------------------TLRR
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           --------------------------------PVEKATT-----------------KKRT
LIMK1_Mmus_LIMK           --------------------------------------E-----------------DLRS
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  EDESDSECVNGAAGGGGDDVYKNNGNGKPA------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            --------------------------------PNSF-GP-----------------GRDK
Tesk_Spur_TESK            --------------------------------PNSPRTPESPEPDIIDAPNGGPMLPRIP
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        ----------------------------------------------------------DK
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ----MGSEKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEIIARIQADPDYLPRTE
TESK1_Hsap_TESK           ---GARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTE
LIMK2_Hsap_LIMK           LRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTL
LIMK1_Hsap_LIMK           LKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTM
LIMK1_Dmel_LIMK           SKSRQRRQRYTVVGNPYWMAPEMMKGLKYDEKLDVFSFGIMLCEIIGRVEADPDFMPRNS
cdi_Dmel_TESK             ----SRKSRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTA
LIMK2_Mmus_LIMK           LRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPRTL
LIMK1_Mmus_LIMK           LKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTM
TESK1_Mmus_TESK           ---GTRKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTE
TESK2_Mmus_TESK           ----IGREKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEIIARIQADPDYLPRTE
DDB0229851_Ddis_LISK-DD1  ----SEKSKMTICGTDDWMAPEVLIGEEYDASCDVFSFGMVLIELITRENLTPR--IRNE
DDB0229853_Ddis_LISK-DD1  ----KDTNNLTICGSENTMSPEVIVGSSYNDSCDVYSYGVLLLELICGSRVVKTQLKRTP
DDB0229854_Ddis_LISK-DD1  ---TKKSRHMTMCGTEGWVAPEILLGMSYDTSCDVFSYGVVLAELITGRKPGVDLWVRSP
DDB0229863_Ddis_LISK-DD1  ----RINKRYTCVGTEIWMAPEVCLDQSYSTAVDVFSFGIVLVEIITEKIPDE--RFPQH
DDB0229865_Ddis_LISK-DD1  ----QNPLSMTICGTDEFMSPEVILGIQYSYSADIYSFGMVLLELITRSKLDER--LPQN
DDB0229866_Ddis_LISK-DD1  ---SRAKRTMTICGTTNCMAPEVVLGQDYNEACDVFSYGIVLSEIITRMDTTNNLRPSSL
DDB0229867_Ddis_LISK-DD1  ---NYRLRRMSICGTPSFMPPEILLQQKYDWSVDVFSFGILCTELITLKRPGKDYWVRSQ
KinX_Ddis_LISK-DD1        ----DNNKSMTICGTDNWMSPEMITGLDYDERSDIFSFGIVLLEIISRVKPAP--YMRDA
KinY_Ddis_LISK-DD1        ---QQGNRHLSICGTDSIMAPELILGMEYDESVDIFSFGVVLLEMILRKKVSK-VLERGP
LIMK_Spur_LIMK            HQPAGRKKRYTMVGTAFWMAPEMLKGKDYNERVDVFSFGIVMCELIGRVSACPDDLPRSG
Tesk_Spur_TESK            SACMDVPRKMSVVGTAFWMAPEVLRGEEYTRQVDVFSFGIVVCEIVARITANPDDLPRTG
CC1G_09729_Ccin_LISK-DD1  ---EEELRRLTFCGTDSYMSPEILLGDEFDLPTDVFSLGIIFCEIAARRLADDRHFKRHP
AqueK481_Aque_LIMK        SKKRNNRSRMTVVGSPYWMAPEMLKGQDYDETVDIFSFGIVLCEIISRVKSDPDELPRLN
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ----KLRRNQSMVGTPYWMAPEVLHGKEYNEKADTYSYGIVLCEIVSRKDADPDEIPR--
AqueK484_Aque_TESK        ----DLRCNQSVVGTPFWMAPEVLHGKRYDKKADTYSYGIVLCEIVSRKDADPDEIPRND


TESK2_Hsap_TESK           --NFGLDY--DAFQH---MV-GDCPPDFLQLTFNCCNMDPKLRPSFVEIGKTL-------
TESK1_Hsap_TESK           --DFGLDV--PAFRT---LVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHL-------
LIMK2_Hsap_LIMK           --DFGLNV--KLFWEK--FVPTDCPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEG
LIMK1_Hsap_LIMK           --DFGLNV--RGFLDR--YCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWL-------
LIMK1_Dmel_LIMK           --DFSLNQ--QEFREK---FCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWL-------
cdi_Dmel_TESK             --SFGLDY--LAFVE---LCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKL-------
LIMK2_Mmus_LIMK           --DFGLNV--KLFWEK--FVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDSF-------
LIMK1_Mmus_LIMK           --DFGLNV--RGFLDR--YCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEQWL-------
TESK1_Mmus_TESK           --DFGLDV--PAFRT---LVGNDCPLPFLLLAIHCCSMEPSTRAPFTEITQHL-------
TESK2_Mmus_TESK           --NFGLDY--DAFQN---MV-GDCPSDFLQLTFNCCNMDPKLRPSFEEIGKTL-------
DDB0229851_Ddis_LISK-DD1  --DLGVDQ--KFFLS---KVPADCPKELLRLVSECCKVAPSGRPSASNILGLL-------
DDB0229853_Ddis_LISK-DD1  MNAFDMNL--EKAEH---LAPESCPRAFMDLAKWCCSYNPKDRPTFKIVVEGL-------
DDB0229854_Ddis_LISK-DD1  ETCFDINP--EELKQ---KSIPGCPSELISVCVECCLYEPLTRPKFDEILSQL-------
DDB0229863_Ddis_LISK-DD1  --RFQFDA--PAFLK---KVPKECPPDFSKLCVDCTKYNPKERPSFIKVLDTI-------
DDB0229865_Ddis_LISK-DD1  --NFDIDY--EELQN---KIPSECPREFLELSMKCCNYDPNDRPSFTDIVQTL-------
DDB0229866_Ddis_LISK-DD1  --KYGLDV--DVLLPL---VPKDCPPPFLKLVLDCTEYDPDNRPTFKEITERL-------
DDB0229867_Ddis_LISK-DD1  --NNGFDINIEELNVN-IPSPNDCPIQFYDLALKCCSYKHTNRPMFSTIVTIL-------
KinX_Ddis_LISK-DD1        --SFGLAE--DIVRNQ--LIPTDCPESLIDLTFNCCSVDPNNRPSFKEISQTL-------
KinY_Ddis_LISK-DD1        QSAFEIDQ--DSARQ---LIPDDIPVLYSDLALDCIKYQPEERPNFSHIIHVL-------
LIMK_Spur_LIMK            --DFGLDE--VPFMAQ---CCDTCPKTFHQIMLMCVRMDSDERPSFDELDQRL-------
Tesk_Spur_TESK            --KFGLDL--QLFKEK---CP-GIPEPFLQIAEDCCSMDPRDRPVFAELVRRF-------
CC1G_09729_Ccin_LISK-DD1  -PTFGIDP--EEVRK---LATPGCPEDFLKLCLDCLNTEPARRPGTREILDRL-------
AqueK481_Aque_LIMK        --SFGLDE--LKFRE---M-RGDCPLLFYNLAVQCTSLNPEERPLFLDIRKGL-------
AqueK482_Aque_TESK        --------------------------------------DPDGRPTFDEIVQML-------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        --NFSLNE--AAFRELPEVIGSPCPPAFIDLACNCSKFVPDERPGFPIIPHPP-------


TESK2_Hsap_TESK           --------------EEILSRLQ-------EE-EQ----ERDR----------------K-
TESK1_Hsap_TESK           --------------EWILEQLP-------EP-AP----LTRT------------------
LIMK2_Hsap_LIMK           PVRRQGKVTIKYDPKELRKHLNLEEWILEQLT-RLYDCQEEEISE---------------
LIMK1_Hsap_LIMK           --------------ETLRMHLA-------GH-LPL----GPQLEQ---------------
LIMK1_Dmel_LIMK           --------------QRLADDLA-------ADRVPP----ERLLHEIETFQEWYASSEDA-
cdi_Dmel_TESK             --------------TLLLEKYE-------HE-SS----AGAS----------------P-
LIMK2_Mmus_LIMK           --------------EALSLFLG-------ELAIPL----PAELED---------------
LIMK1_Mmus_LIMK           --------------ETLRMHLS-------GH-LPL----GPQLEQ---------------
TESK1_Mmus_TESK           --------------EQILEQQP-------EA-TP----LAKP------------------
TESK2_Mmus_TESK           --------------KEIMSRLP-------EE-EL----ERDR----------------K-
DDB0229851_Ddis_LISK-DD1  --------------EYILESEL-------IV-NSG---G-D-----------------Y-
DDB0229853_Ddis_LISK-DD1  --------------KVLTNQQL-------KD-LPV---K-G-------------------
DDB0229854_Ddis_LISK-DD1  --------------KVCQNNLK-------VA-TAA---A-AA------------------
DDB0229863_Ddis_LISK-DD1  --------------QNIYDSLP-------DD-D---------------------------
DDB0229865_Ddis_LISK-DD1  --------------DQLAIKLV-------KE-TPD---G-PY----------------P-
DDB0229866_Ddis_LISK-DD1  --------------KSLTKKLS-------TP-HIL---P---------------------
DDB0229867_Ddis_LISK-DD1  --------------ESIKLQLE-------LF-ENQ---Q---------------------
KinX_Ddis_LISK-DD1        --------------KQIKTTLD-------SN-IVY---P---------------------
KinY_Ddis_LISK-DD1        --------------KQLTSLFP-------VV-HTF---D--N------------------
LIMK_Spur_LIMK            --------------SSFSLHFE-------RL-SPR----AKDLES---------------
Tesk_Spur_TESK            --------------EIIRGTLD-------TE-TSD----TTCYD----------------
CC1G_09729_Ccin_LISK-DD1  --------------RLIEAEVL-------AR-PAE---DGDV----------------N-
AqueK481_Aque_LIMK        --------------SHYINLIE-------SN-SPL----PDNLYD---------------
AqueK482_Aque_TESK        --------------DPLVSAYQ-------SN-STP---PPAP----------------P-
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        --------------A-IMTNLR-------EN-YL----VLLQ----------------SL


TESK2_Hsap_TESK           -LQP-----TA-------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           -LSPTSQRSLNN--LDELVKSAVDSE------------IS--------------------
cdi_Dmel_TESK             -LSSLE---LINCSP---------GGSDSENVTLTPRASV--PTVATICTAPAGTLTPRH
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           -LQP-----TA-------------------------------------------------
DDB0229851_Ddis_LISK-DD1  -EPPLR--SFKP--P---------EL------------HL--------------------
DDB0229853_Ddis_LISK-DD1  ---KSK--PYID------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ---AAA--AAAAAAA---------VV------------ST--PT----------------
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  -STPIV---VSN--P---------HF------------DDQSI-----------------
DDB0229866_Ddis_LISK-DD1  ---PLR--VLAQ--S---------PL------------TS--P-----------------
DDB0229867_Ddis_LISK-DD1  ---QQQ--QLQQ-QQ---------QL------------QQ--Q-----------------
KinX_Ddis_LISK-DD1        ---EIR--DFEQ------------------------------------------------
KinY_Ddis_LISK-DD1        ---PL----------------------------------S--P-----------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ----V---NL-----------------------------T--------------------
CC1G_09729_Ccin_LISK-DD1  -VGSVR--FI----S---------GA------------RR--P-----------------
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        -IAP-----LSN--P---------SS----------------P-----------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        EVDP-----V--------------------------------------------------


TESK2_Hsap_TESK           -----------------RGLLEKAPGV---------KRL-S-S------LD---------
TESK1_Hsap_TESK           ------------------------ALT---------HNQ-G-S------VA---------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           -------------------PVEK-------------EKE-N-MVIKPQDI----------
cdi_Dmel_TESK             LQEVDEDGFRFPSKKSASAALPGTPNGS--------AGS-S-G------FD---------
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           -------------------PLTKAPLT---------YNQ-G-S------VP---------
TESK2_Mmus_TESK           -----------------KGPLEKVPGG---------KRL-S-S------LD---------
DDB0229851_Ddis_LISK-DD1  -------------------------------------------P-----LNE---KNN--
DDB0229853_Ddis_LISK-DD1  ------------------------------------PDE-D-SF-----IDPND------
DDB0229854_Ddis_LISK-DD1  -I---------------QTPII--------------QTP-NIS------FSPNNSNNNNN
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ---------------------------NDWCMLSLIPDDCL-EN-----LNEFA-EIE--
DDB0229866_Ddis_LISK-DD1  -I---------------QSPISTKNQFN--------PNL-F-KS-----IVHNN-HNH--
DDB0229867_Ddis_LISK-DD1  -Q---------------QQQQQQQ-QQQ--------QQ--Q-LQ-----LQQQQ-SSE--
KinX_Ddis_LISK-DD1        ----------------------------------------Q-QK-----ISTTN---G--
KinY_Ddis_LISK-DD1        -T---------------SSPIT--------------PRK-N-S------LN---------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            -------------------D-----------------------------II---------
CC1G_09729_Ccin_LISK-DD1  -G---------------AAPRI--PSFG--------------------------------
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        -SKVELPAELCPSPQS--------PS----------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        -----------------------LPFL---------YAE-G-L------LT---------


TESK2_Hsap_TESK           --------DK--------------------I-----P-----------------------
TESK1_Hsap_TESK           --------RG--------------------G-----P-----------------------
LIMK2_Hsap_LIMK           -----------------------------------------L------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           ------------------------------------PKSPHLGKDFSPSGERLRDSM---
cdi_Dmel_TESK             --------DH--------------------I-----L----------K-SRVRRATQKLE
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           --------RG--------------------G-----P-----------------------
TESK2_Mmus_TESK           --------DK--------------------I-----P-----------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  NNNNISNISPDITTGIQQINLSSSGGSNNSS-----PSTPPQGSQLVSLAQSRRNTM---
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        --------SP--------------------F-----TKS------------MRMNSF---
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            --------RT--------------------NDSDDDDDDCSFGFQFQTDLDDKRRSG---
CC1G_09729_Ccin_LISK-DD1  --------MG--------------------V-----GKD------------IRGGSG---
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           ------------------------------------------------------------
cdi_Dmel_TESK             AEILLHRRSLSENIIHFP------------------------------------------
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  ---SLHRKSMELNLVDGQLSTTPPPTSPIQSRPHKPSDSIWKIAAKPKHVGYQTLKRKQG
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ---DFN------------LSNIVSSTS---------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------MSSA--------------------------------------
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           ------------------------------------------------------------
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  PCYAALTSHITKMIERATSDYYYDTSYIQDFLLAYRCFAPPQQIFELLLSRYIANSPDNF
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           ------------------------------------------------------------
cdi_Dmel_TESK             ------------------------------------------------------------
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           ------------------------------------------------------------
TESK2_Mmus_TESK           ------------------------------------------------------------
DDB0229851_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229854_Ddis_LISK-DD1  TNDINGWKKVQRVIQLRVIIFFKRWIDYYPQDFLEEAMEDNLNEFDKISAQQNSSTALLL
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229866_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229867_Ddis_LISK-DD1  ------------------------------------------------------------
KinX_Ddis_LISK-DD1        ------------------------------------------------------------
KinY_Ddis_LISK-DD1        ------------------------------------------------------------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ------------------------------------------------------------
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ---------------------------------------------HKS------------
TESK1_Hsap_TESK           ---------------------------------------------SA-------------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           ------------------------------------------------------------
cdi_Dmel_TESK             --------------------------------------------MHTS------------
LIMK2_Mmus_LIMK           ------------------------------------------------------------
LIMK1_Mmus_LIMK           ------------------------------------------------------------
TESK1_Mmus_TESK           ---------------------------------------------SA-------------
TESK2_Mmus_TESK           ---------------------------------------------HKS------------
DDB0229851_Ddis_LISK-DD1  ----------------------------------------NNKNNNNNN---N-------
DDB0229853_Ddis_LISK-DD1  ------------------------------------------DSNNNNN---S-------
DDB0229854_Ddis_LISK-DD1  GTTISNNELLIDPKLMTELQKKRSELELLIQINSPSDFINNNNNNNN-N-PVN-------
DDB0229863_Ddis_LISK-DD1  ------------------------------------------------------------
DDB0229865_Ddis_LISK-DD1  ----------------------------------------NNINNNNNN-----------
DDB0229866_Ddis_LISK-DD1  ----------------------------------------SSSSNNSSG---Y-------
DDB0229867_Ddis_LISK-DD1  ----------------------------------------SSSSSSSQP---L-------
KinX_Ddis_LISK-DD1        ----------------------------------------NNKQNGGAP---K-------
KinY_Ddis_LISK-DD1        --------------------------------------VQNNLKSQNLNFTLL-------
LIMK_Spur_LIMK            ------------------------------------------------------------
Tesk_Spur_TESK            ------------------------------------------------------------
CC1G_09729_Ccin_LISK-DD1  ----------------------------------------------SSA---SSDESDEE
AqueK481_Aque_LIMK        ------------------------------------------------------------
AqueK482_Aque_TESK        ------------------------------------------------------------
AqueK483_Aque_TESK        ------------------------------------------------------------
AqueK484_Aque_TESK        ------------------------------------------------------------


TESK2_Hsap_TESK           ------------------------------------------------------------
TESK1_Hsap_TESK           ------------------------------------------------------------
LIMK2_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Hsap_LIMK           ------------------------------------------------------------
LIMK1_Dmel_LIMK           ------------------------------------------------------------
cdi_Dmel_TESK             ---------------------------------------------