Protein (view, download) , Domain (view, download)
IRE2_Hsap        MASAVRGSR-------------------------------------PWPR--L-GLQL--
IRE1_Hsap        MPARRLLLL----------------------------------------------LTL--
ire-1_Dmel       MRFCVVVCC-------------------------------------V--------LFL--
IRE2_Mmus        MARPVQRFQ-------------------------------------LWSP--L-GFLL--
IRE1_Mmus        MPARWLLLL----------------------------------------------LAL--
ire-1_Cele       MRATFHLFT-------------------------------------F-------IFLL--
IRE1_Scer        MRLLRRNML-------------------------------------VL-T----LLVC--
IreA_Ddis        MTFSKTRNK-------------------------------------II-F--L-LFLI--
IrlA_Ddis        MTKPIFKSK-------------------------------------TK-P--L-GWSK--
IrlB_Ddis        MNSLLNNLI---------------------------------------------------
IrlB_C2d_Ddis    MNSLLNNLI---------------------------------------------------
IrlC_Ddis        MKSNYST---------------------------------------YL-Y--K-MSE--L
IrlD_Ddis        MGPKKGKRSHSKNHHHHNNGNNNNNNNSGGGSSSDILYTYSQDTRILL-F--K-VILTQN
IrlE_Ddis        MGKKKIDIN----------------------------------TREDL-F--L-SY---Y
IrlF_Ddis        MNFNFEQIL---------------------------------------------------
IrlF_C2d_Ddis    MNFNFEQIL---------------------------------------------------
10577_Tthe       MTDLKVVVS----------------------------------------E--L-KF----
IRE1_Spur        MF----------------------------------------------------------
CC1G_06931_Ccin  MAFVFFLQF----------------------------------------------LLL--
AqueK159_Aque    MLARDQPRD----------------------------------------------FTWL-
AqueK160_Aque    MLLVYRFSD-------------------------------------TF--------ESQ-
AqueK161_Aque    YD----------------------------------------------------------
AqueK162_Aque    PESS--------------------------------------------------------
AqueK163_Aque    MSSSQEVVA-------------------------------------SL-SHSLPLFIIE-
AqueK164_Aque    MYCQSLII----------------------------------------------------
AqueK165_Aque    MVNLSRSLP---------------------------------------------EFLVD-
AqueK166_Aque    MTDPDP------------------------------------------------SFSIN-
AqueK167_Aque    MLELDSSLT------------------------------------------------IA-
AqueK168_Aque    MNSSVPWLL-------------------------------------L--------FSV--
AqueK169_Aque    MAQLAVFDG-------------------------------------GR---I----LNI-
IRE-2_Smoe       MLKDFKPLF---------------------------------------------------
IRE-1_Smoe       MLKDFKPLF---------------------------------------------------


IRE2_Hsap        --Q-------F---AALLLGT----------------------L----------------
IRE1_Hsap        --L-------L---PGL--GI----------------------F----------------
ire-1_Dmel       --L-------A---SGLIASAT---AK-------------S-QQ----------------
IRE2_Mmus        --Q-------L---VTL-LGK----------------------L----------------
IRE1_Mmus        --L-------L---PPPGPGS----------------------F----------------
ire-1_Cele       --L-------F---SSVIC-IS---TP-------------G-FR----------------
IRE1_Scer        --V-------F---SSIIS-CS---IP-------------LSSR----------------
IreA_Ddis        --I-------I---N-IF-NI----------------------N----------------
IrlA_Ddis        --I-------S---S-K-------------------------------------------
IrlB_Ddis        ------------------------------------------------------------
IrlB_C2d_Ddis    ------------------------------------------------------------
IrlC_Ddis        ERI-------V---NG----------------------------------GDV-------
IrlD_Ddis        EEIICMVIQIA---YGLP-GL----------------------PKISDISRDLGILILKL
IrlE_Ddis        K-----------------------------------------------------------
IrlF_Ddis        ------------------------------------------------------------
IrlF_C2d_Ddis    ------------------------------------------------------------
10577_Tthe       -----------------N-NE----------------------K----------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  --I-------V---GAVCWA-E---IV-------------N-VR----------------
AqueK159_Aque    --S-------L---LASL------------------------------------------
AqueK160_Aque    ------------QRI---------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    --E-------YEKLLAII-NIKLPPNPSQGPSHRFWDLFNA--H----------------
AqueK164_Aque    ------------------------------------------------------------
AqueK165_Aque    --H-------YMRLMAVV-GVKSGLEPDWSLSRRFLELYST--H----------------
AqueK166_Aque    --R-------VILIIY--------------------------------------------
AqueK167_Aque    --T-------SPS-----------------------------------------------
AqueK168_Aque    --G-------F---FS-----C---LP-------------S-TD----------------
AqueK169_Aque    ------------NDL---------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        SP----------------------------------------------------------
IRE1_Hsap        GS----------------------------------------------------------
ire-1_Dmel       GD-----------------------------------------------------S----
IRE2_Mmus        GP----------------------------------------------------------
IRE1_Mmus        GR----------------------------------------------------------
ire-1_Cele       ND-----------------------------------------------------H----
IRE1_Scer        TSRRQIVEDEVASTKKLNFNYGVDKNINSP---------------------IPAPRTT--
IreA_Ddis        AY-------------------------------------------------I--------
IrlA_Ddis        EV-------------------------------------------------I--------
IrlB_Ddis        ------------------------------------------------------------
IrlB_C2d_Ddis    ------------------------------------------------------------
IrlC_Ddis        SSIFIEQDD---------------------------------------------------
IrlD_Ddis        PNRTIRELELFLESKNIYFREDQHINYLNEIPQPTTTTTSPPPPPPPSSIST--------
IrlE_Ddis        ------------------------------------------------------------
IrlF_Ddis        ------------------------------------------------------------
IrlF_C2d_Ddis    ------------------------------------------------------------
10577_Tthe       QQQ---------------DN-------------------------------Y--------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ST-------------------------------------------------IPAAETAAL
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    AA----------------------------------------------------------
AqueK164_Aque    ------------------------------------------------------------
AqueK165_Aque    AS----------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    SD----------------------------------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ------------------------------------------------QVH-TLRP----
IRE1_Hsap        ------------------------------------------------TST-VTLP----
ire-1_Dmel       -----------------------------------AEVVSSGEDEKTDCTDLARDE----
IRE2_Mmus        ------------------------------------------------QVQ-SVRP----
IRE1_Mmus        ------------------------------------------------TST-VTLP----
ire-1_Cele       --------------------------------------------E--SIGDDEEKT----
IRE1_Scer        --EGLPNMKLSSYPTPNLLNTADNRRANKKGRRAANSISV-PYLENRSLN--ELSL----
IreA_Ddis        -------------------------------------------------KDE-NED----
IrlA_Ddis        -------------------------------------------------NED-EEEEEGG
IrlB_Ddis        ------------------------------------------------------------
IrlB_C2d_Ddis    ------------------------------------------------------------
IrlC_Ddis        ------------------------------------------------------------
IrlD_Ddis        -------------------------------------------------TTT-TTT----
IrlE_Ddis        ------------------------------------------------------------
IrlF_Ddis        ------------------------------------------------------------
IrlF_C2d_Ddis    ------------------------------------------------------------
10577_Tthe       -------------------------------------------------GME-DQHST--
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  IQRTRPA----------------------------PTYATGGILE--PTK--DLEL----
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    --------------------------------------------Q--KGS----------
AqueK164_Aque    ------------------------------------------------------------
AqueK165_Aque    --------------------------------------------K--K------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    --------------------------------------------Q--SSSDIALAY----
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ---------------------------------------------------ENLLLVS--
IRE1_Hsap        ---------------------------------------------------ETLLFVS--
ire-1_Dmel       ---------------------------------------------------EALMVFS--
IRE2_Mmus        ---------------------------------------------------ESLLFVS--
IRE1_Mmus        ---------------------------------------------------ETLLFVS--
ire-1_Cele       ---------------------------------------------------SSTILVS--
IRE1_Scer        ---------------------------------------------------SDILIAA--
IreA_Ddis        ---------------------------------------------------DLSLLIS--
IrlA_Ddis        EEGGEEEEIDNNKNSNNSSSNSNNNNNDNNNNNGEERKVEKEEEKEEINHYRNQFEKD--
IrlB_Ddis        ------------------------------------------------------------
IrlB_C2d_Ddis    ------------------------------------------------------------
IrlC_Ddis        ------------------------------------------------------------
IrlD_Ddis        ---------------------------------------------------ATAIEIESS
IrlE_Ddis        ------------------------------------------------------------
IrlF_Ddis        ------------------------------------------------------------
IrlF_C2d_Ddis    ------------------------------------------------------------
10577_Tthe       ---------------------------------------------------ELS-IAG--
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ---------------------------------------------------LDIVLVA--
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ---------------------------------------------------SLEVAVT--
AqueK164_Aque    ---------------------------------------------------------D--
AqueK165_Aque    ---------------------------------------------------SPQVAAS--
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ---------------------------------------------------KDLLLFS--
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       --------------------------------------------------------XX--
IRE-1_Smoe       --------------------------------------------------------FQ--


IRE2_Hsap        ------TLDGSLHALS-KQTG---------------------------------------
IRE1_Hsap        ------TLDGSLHAVS-KRTG---------------------------------------
ire-1_Dmel       ------TLGGGLTAID-PVTS---------------------------------------
IRE2_Mmus        ------TLDGSLHALN-KQTG---------------------------------------
IRE1_Mmus        ------TLDGSLHAVS-KRTG---------------------------------------
ire-1_Cele       ------TIDGRLRALD-SETG---------------------------------------
IRE1_Scer        ------DVEGGLHAVD-RRNG---------------------------------------
IreA_Ddis        ------TLDGNIYSFN-YESG---------------------------------------
IrlA_Ddis        ------LLDMELKALN-RETIDNILSGL--------------------------------
IrlB_Ddis        ------------------------------------------------------------
IrlB_C2d_Ddis    ------------------------------------------------------------
IrlC_Ddis        ------------------------------------------------------------
IrlD_Ddis        SGLTSNITDSTEIQLD-STTTDTKTT-STTSTTTNNSSDSNNNNNNNNNNNSNNILNFPF
IrlE_Ddis        ------------------------------------------------------------
IrlF_Ddis        ------------------------------------------------------------
IrlF_C2d_Ddis    ------------------------------------------------------------
10577_Tthe       ------------------------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ------SIDGKFHALS-RSTG---------------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------YLYTILNGLEWKELA---------------------------------------
AqueK164_Aque    ------QLDERA------------------------------------------------
AqueK165_Aque    ------YVDKLLTGLGYEEMG---------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ------TLDGKLYAVD-KVTG---------------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------XXXXXXXXXX-XXXX---------------------------------------
IRE-1_Smoe       ------RTDYSLTCFE-VSTG---------------------------------------


IRE2_Hsap        ----------------------DLKW--TLRDDPVIEG----------------------
IRE1_Hsap        ----------------------SIKW--TLKEDPVLQV----------------------
ire-1_Dmel       ----------------------EIRW--TIADDPPIVA----------------------
IRE2_Mmus        ----------------------DLKW--TVKDDPIIQG----------------------
IRE1_Mmus        ----------------------SIKW--TLKEDPVLQV----------------------
ire-1_Cele       ----------------------EIKW--TLQEEPVLRS----------------------
IRE1_Scer        ----------------------HIIW--SIEPENF----------Q--------------
IreA_Ddis        ----------------------ELNW--DLKPNGGD----SLYST-SQFD----------
IrlA_Ddis        ---------------NSYEIFKEVNF--DFEKLYSI----IISEPPPLFD--------T-
IrlB_Ddis        ---------------------IDYEY--DLIKVHHH----IQKN-IFIFP----------
IrlB_C2d_Ddis    ---------------------IDYEY--DLIKVHHH----IQKN-IFIFP----------
IrlC_Ddis        ----------------VLGEIKNFNY--DLYTKYDSL---VLKD-PQTQN----------
IrlD_Ddis        NCQNKSKQKRPISKEESFNKMVQYNF--DLGKIFDE----FTRE-VLLDDLKNDLKIDNI
IrlE_Ddis        -------------------EIEKNKF--DLLKIC--------SD-KN-------------
IrlF_Ddis        ----------------------EYNF--DFKKLHKN----KLKN-NNLSE----------
IrlF_C2d_Ddis    ----------------------EYNF--DFKKLHKN----KLKN-NNLSE----------
10577_Tthe       ------------------------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ----------------------KILW--SMPAFARAEGSSTLSSLA--------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------ET----------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ----------------------KLKA--FIKNDVKVDV----------------------
AqueK164_Aque    --------------------------------A---------------------------
AqueK165_Aque    ----------------------EFSVYRYLHTEVDLDS----------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ----------------------DTLW--KLNSKSPIVT----------------------
AqueK169_Aque    ------------------------------------N-----------------------
IRE-2_Smoe       ----------------------XXXX--XXXXXXXX------------------------
IRE-1_Smoe       ----------------------SVKW--TIRFSEVA------------------------


IRE2_Hsap        --------------------------PM--------------------------------
IRE1_Hsap        --------------------------PT--------------------------------
ire-1_Dmel       ---------------EH---------QE--------------------------------
IRE2_Mmus        --------------------------PM--------------------------------
IRE1_Mmus        --------------------------PT--------------------------------
ire-1_Cele       --------------------------PS--------------------------------
IRE1_Scer        ----------PLIE-IQE--------PS--------------------------------
IreA_Ddis        --------------RKQQQ-STSTSTEI--------------------------------
IrlA_Ddis        ------------FFDSVSS-FEIFFTDCLILLCSNFPDGIDTSI----------------
IrlB_Ddis        --------------FKKQH-YHSTVLECLINLCSKLKYDENENLN---------------
IrlB_C2d_Ddis    --------------FKKQH-YHSTVLECLINLCSKLKYDENENLN---------------
IrlC_Ddis        ------------NSPKPPS-LEIFILVNLIALCGRI----NDKFP---------------
IrlD_Ddis        PIDNISISPTPIISPVFQE-YDLFLMDSFIILCGQL----DNVKL---------------
IrlE_Ddis        ------------FSKSNFL-KAVHCLFSLSYFCKIK--DENEEEEGKEEEINDYKVKKST
IrlF_Ddis        ---------------NEDD-YATTVIECLIHLCEVIPT--NKIY----------------
IrlF_C2d_Ddis    ---------------NEDD-YATTVIECLIHLCEVIPT--NKIY----------------
10577_Tthe       ------------------------NQES--------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ----------PLVR-TTHPENDPDDFDD--------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------------------------------------------------
AqueK164_Aque    --------------------------HCTV------------------------------
AqueK165_Aque    ------------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    --------------------------HL--------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        -----------------------------------------YVT-EM-A---FLSDP-AD
IRE1_Hsap        -----------------------------------------HVE-EP-A---FLPDP-ND
ire-1_Dmel       -----------------------------------------NVQ-VP-H---FLPDP-RD
IRE2_Mmus        -----------------------------------------YVT-EM-A---FLSDP-AD
IRE1_Mmus        -----------------------------------------HVE-EP-A---FLPDP-ND
ire-1_Cele       -----------------------------------------AVKQGF-T---FLPNP-LD
IRE1_Scer        -----------------------------------------RLETYE-T---LIIEPFGD
IreA_Ddis        -----------------------------------------TKS-SP-S---ILIPT-LD
IrlA_Ddis        ---------------------------------TRPNFN-DFYN-HF-KDRGVINK----
IrlB_Ddis        ---------------------------------SLDQFKIIFYN-ES-K---FLNKN-LK
IrlB_C2d_Ddis    ---------------------------------SLDQFKIIFYN-ES-K---FLNKN-LK
IrlC_Ddis        ---------------------------------NLDKFLTH-YK-YATNIFNLLSEN-II
IrlD_Ddis        ---------------------------------TLEEFKDY-YK-KY----KLLNQ----
IrlE_Ddis        TGNYYRNSEGKLFKKSNEKDQIDDVSIFYKRLPTIQDFKDT-YD-KYEN---CLN-----
IrlF_Ddis        ------------------------------------------------------------
IrlF_C2d_Ddis    ------------------------------------------------------------
10577_Tthe       -----------------------------------------NFE-RY-D---YFLPS-SD
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  -----------------------------------------DT-TPE-T---YIIEP-QS
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------------------------------------------------
AqueK164_Aque    --------------------------------------------------------S-VD
AqueK165_Aque    ------------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    -----------------------------------------SSS-SY-L---YLTDP-KD
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        G-----------------------------------------SLY-------ILGTQKQQ
IRE1_Hsap        G-----------------------------------------SLY-------TLGSKNNE
ire-1_Dmel       G-----------------------------------------SIY-------QLGQ--MG
IRE2_Mmus        G-----------------------------------------SLY-------VLGTQKQQ
IRE1_Mmus        G-----------------------------------------SLY-------TLGGKNNE
ire-1_Cele       G-----------------------------------------SLY-------VL---KNS
IRE1_Scer        G-----------------------------------------NIY-------YFNA--HQ
IreA_Ddis        G-----------------------------------------SGL-------LFQY-SND
IrlA_Ddis        -YIS----RENIHK-ALNDKLMTDYFNS--GIYLGLLDTLDI--AAIRFITIFGKF-LSY
IrlB_Ddis        EYLE----ILKNSK-EINKHVICDYFEK--D-NNGSEEKNQNSSIVFNFLNCFKDY-LSM
IrlB_C2d_Ddis    EYLE----ILKNSK-EINKHVICDYFEK--D-NNGSEEKNQNSSIVFNFLNCFKDY-LSM
IrlC_Ddis        NSIEKFKETLSKDLPSFQLSVIA----------NSSIVKKDN--SIIKFLSCFGSF-MKL
IrlD_Ddis        -YIEDFKDNLINDF-LVTVEILA----------SWYIPQKDY--SIVKFINCFGEM-LDS
IrlE_Ddis        SVYYIIRKIKLLHL-EYFWEILA----------SCY---GTI--SFIKFFNIFSNE-I-F
IrlF_Ddis        -------------------------------------------SGANKFISCFYEF-MNE
IrlF_C2d_Ddis    -------------------------------------------SGANKFISCFYEF-MNE
10577_Tthe       G-----------------------------------------NFI-------FLAS-DST
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  G-----------------------------------------HIY-------VVNS-EDD
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    --------------------------------------------------------KVTE
AqueK164_Aque    DSLY----------------VWAGYQDGLPG-VHDSEEKRKVTSNIQHFTPSSGQW-IT-
AqueK165_Aque    --------------------------------------------------------KVNE
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    G-----------------------------------------SLY-------MSGP-QSD
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        G-LM-------KLPFT--------------------------------------------
IRE1_Hsap        G-LT-------KLPFT--------------------------------------------
ire-1_Dmel       S-LK-------KLPYT--------------------------------------------
IRE2_Mmus        G-LM-------KLPFT--------------------------------------------
IRE1_Mmus        G-LT-------KLPFT--------------------------------------------
ire-1_Cele       S-LK-------KLPFN--------------------------------------------
IRE1_Scer        G-LQ-------KLPLS--------------------------------------------
IreA_Ddis        R-LH-------QVPFS--------------------------------------------
IrlA_Ddis        EVVE-------TISNS-------LFRYRTDKIEF-----------------LSDIIRELL
IrlB_Ddis        DIIE-------FIVRGISFQVRSYCNLIKPIEQWKQKTYQQRYQQFKKALHLNNEVYKRI
IrlB_C2d_Ddis    DIIE-------FIVRGISFQVRSYCNLIKPIEQWKQKTYQQRYQQFKKALHLNNEVYKRI
IrlC_Ddis        ESIE-------YFGSV-------FNSLIGEEDQFSLDLLQ-------VLIDSSNEYKKFL
IrlD_Ddis        TIIE-------SFSYI-------FNKTIKKEDDWSISFIQ-------AALGSNEEFKRQV
IrlE_Ddis        SPSENGDSVFIMVGKF-------FRRKVRAETHYDLIFLK-------IIL-ANASI-PMI
IrlF_Ddis        RFIE-------TLVLE-------FYDLMTTD---NSKVTTGIFDQFFSLIKKSDIIYKSF
IrlF_C2d_Ddis    RFIE-------TLVLE-------FYDLMTTD---NSKVTTGIFDQFFSLIKKSDIIYKSF
10577_Tthe       P-IK-------IMRDE--------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  S-LQ-------RFPFS--------------------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    K-VD-------H------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    A-LT-------RVKND--------------------------------------------
AqueK164_Aque    ---R-------STTGTPPLGVRS-------------------------------------
AqueK165_Aque    K-LE-------KLMKF--------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    G-IK-------RLPLT--------------------------------------------
AqueK169_Aque    E-LI-------R------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ------------------------------------------------------------
IRE1_Hsap        ------------------------------------------------------------
ire-1_Dmel       ------------------------------------------------------------
IRE2_Mmus        ------------------------------------------------------------
IRE1_Mmus        ------------------------------------------------------------
ire-1_Cele       ------------------------------------------------------------
IRE1_Scer        ------------------------------------------------------------
IreA_Ddis        ------------------------------------------------------------
IrlA_Ddis        LCNEKY----RT----------------LSKSYDLVQKRLQKEEFTFIKVFEDDDPKLF-
IrlB_Ddis        VCNGVW----KSEKLDYI-YRYKS------------------DQLSLVGIIESDCSDLFI
IrlB_C2d_Ddis    VCNGVW----KSEKLDYI-YRYKS------------------DQLSLVGIIESDCSDLFI
IrlC_Ddis        QIL----------EFNQLQKYYD------------------DGHLCLFHSIKFDNLNEFK
IrlD_Ddis        MCL----------NDELIQDRYD------------------QSLYSIMHPIKFDNVREFI
IrlE_Ddis        LKLGVKDIGRFTEKEDII-VSYY-------------------RNFSIIHSLRFDNVKEFA
IrlF_Ddis        Y---EW----DSNILENR-FIFKNNNNNIDGDDDDGNEDDYFGRFSILSILEDDNSHII-
IrlF_C2d_Ddis    Y---EW----DSNILENR-FIFKNNNNNIDGDDDDGNEDDYFGRFSILSILEDDNSHII-
10577_Tthe       ------------------------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ------------------------------------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------------------------------------------------
AqueK164_Aque    ------------------------------------------------------------
AqueK165_Aque    ------------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ------------------------------------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ----------------------------------------------------------IP
IRE1_Hsap        ----------------------------------------------------------IP
ire-1_Dmel       ----------------------------------------------------------IP
IRE2_Mmus        ----------------------------------------------------------IP
IRE1_Mmus        ----------------------------------------------------------IP
ire-1_Cele       ----------------------------------------------------------IP
IRE1_Scer        ----------------------------------------------------------IR
IreA_Ddis        ----------------------------------------------------------LQ
IrlA_Ddis        SALYQPPDIIKLITEP------------------------EKDSGFWCMIGIFKSKRILD
IrlB_Ddis        STLLID------SNSY------------------------EQLENVWRLICNFDSFSIAS
IrlB_C2d_Ddis    STLLID------SNSY------------------------EQLENVWRLICNFDSFSIAS
IrlC_Ddis        LLFN-D------STWCQQQ----------------QQQQQINPQIFWFILCKYNSSKIAH
IrlD_Ddis        LIYSRD------ENY-------------------------FEPQEFWYLICKYDAIAITQ
IrlE_Ddis        LVYKTL------KNNYPSKKKKKITLFEENGKINVKTS--KKDLMLFEFVCKFDCVKIFK
IrlF_Ddis        SNYFKF-------TNY------------------------ERLEDLWIMICHYQATDIAK
IrlF_C2d_Ddis    SNYFKF-------TNY------------------------ERLEDLWIMICHYQATDIAK
10577_Tthe       ----------------------------------------------------------ID
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ----------------------------------------------------------MA
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ----------------------------------------------------------LP
AqueK164_Aque    ------------------------------------------------------------
AqueK165_Aque    ----------------------------------------------------------RP
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ----------------------------------------------------------IP
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ELV-HASPCRSS-----------------------------DGVFYT------------G
IRE1_Hsap        ELV-QASPCRSS-----------------------------DGILYM------------G
ire-1_Dmel       QLV-ANAPCRSS-----------------------------DGILYS------------G
IRE2_Mmus        ELV-HASPCRSS-----------------------------DGVFYT------------G
IRE1_Mmus        ELV-QASPCRSS-----------------------------DGILYM------------G
ire-1_Cele       QLV-HASPCKGN-----------------------------DGILYA------------G
IRE1_Scer        QLV-STSPLHLKTN----------------IVVNDSGKIVEDEKVYT------------G
IreA_Ddis        ELV-NTSPLFLKELEDKSSTSSTSTTSESSK-------DENKVTMFI------------G
IrlA_Ddis        YLI-RTEPSKS---------------------------------WFK------------G
IrlB_Ddis        KFLIEFFKLDK-----------------------------------VNNKLNFSIHPSSD
IrlB_C2d_Ddis    KFLIEFFKLDK-----------------------------------VNNKLNFSIHPSSD
IrlC_Ddis        YLL-NDYQI------------------------------------------------NK-
IrlD_Ddis        HII-NNNIA------------------------------------------------EED
IrlE_Ddis        KYFLPKPQI-------------------------------------INNNDN-----NEM
IrlF_Ddis        ALF-NLYY---------------------------------------------------D
IrlF_C2d_Ddis    ALF-NLYY---------------------------------------------------D
10577_Tthe       QVI-KICPMS-----------------------------GNESKYI-------------A
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ELV-DMSPFTSPG--------------------------DDEKRVFI------------G
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    KRI-I-------------------------------------------------------
AqueK164_Aque    ------YC---------------------CT-------SINDQLYYF------------G
AqueK165_Aque    AVL-Q-------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ELV-KISPCSSS-----------------------------DGLLYS------------G
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        R-KQDAWFVVDP-----ESGETQM----------------TLTTE---------------
IRE1_Hsap        K-KQDIWYVIDL-----LTGEKQQ----------------TLSSAF-----AD-------
ire-1_Dmel       K-KSDTWYMVDP-----KTGRREK----------------VMGFGDA---TVD----GKE
IRE2_Mmus        R-KQDAWFVVDP-----ESGETQM----------------TLTTE---------------
IRE1_Mmus        K-KQDIWYVIDL-----LTGEKQQ----------------TLSSAF-----AD-------
ire-1_Cele       S-KKDVWFGIDP-----KTGLKVEYILLNISDKILFLQVETLSSA-----SAD-------
IRE1_Scer        S-MRTIMYTINM-----LNGEIIS----------------AFGPGSKNGYFGSQSVDCSP
IreA_Ddis        N-KKTSITVVDS-----QTGEIIK----------------SMSKDGL---WLT-------
IrlA_Ddis        K-ESDYFFSI--------------------------------------------------
IrlB_Ddis        A-NENYKR----------------------------------------------------
IrlB_C2d_Ddis    A-NENYKR----------------------------------------------------
IrlC_Ddis        ---KS-L-----------------------------------------------------
IrlD_Ddis        LSKRS-GKTY--------------------------------------------------
IrlE_Ddis        LE-CI-SSGS--------------------------------------------------
IrlF_Ddis        S-KEDCISVF--------------------------------------------------
IrlF_C2d_Ddis    S-KEDCISVF--------------------------------------------------
10577_Tthe       F-TKEKILLVNP-----ENGELEK----------------FEDIEDD---YEN-------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  R-KETSLLLLEL-----ETGRIKA----------------TLNSECP--PYDDRRIDLDE
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ----------DLGD---QLGE---------------------------------------
AqueK164_Aque    G-----------------------------------------------------------
AqueK165_Aque    ----------VVRELCLCLHD---------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    S-KQDSWIAVDA-----LTGRKLY----------------SFSSHD----GMN-------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        -------G-----PSTPRLYIGR-TQYTVTM---HDPRAP-----ALRWNTTYR-RYSAP
IRE1_Hsap        -----SLC-----PSTSLLYLGR-TEYTITM---YDTKTR-----ELRWNATYF-DYAAS
ire-1_Dmel       G---EQIGW----ATSRAIYLGR-TQYTVMM---YDSLAKNKD--AKPWNITFY-DYNAV
IRE2_Mmus        -------G-----LSTPQLFIGR-TQYTVSM---HDLRTP-----ALRWNTTYR-RYSAP
IRE1_Mmus        -----SLC-----PSTSLLYLGR-TEYTITM---YDTKTR-----ELRWNATYF-DYAAS
ire-1_Cele       -----RICPAN---QKQTIFLGR-TEYRVSM---FDEKNR-----GKTWNATFN-DYSAH
IRE1_Scer        E---EKIKL---QECENMIVIGK-TIFELGI---HSYD--G-----ASYNVTYS-T----
IreA_Ddis        ---DEDDCPVNI-IPDEALMFTR-SDYQIIA---LDPKSG-----VEKWNLSVG-EYIPH
IrlA_Ddis        ------------------------------------------------------------
IrlB_Ddis        ------------------------------------------------------------
IrlB_C2d_Ddis    ------------------------------------------------------------
IrlC_Ddis        ------------------------------------------------------------
IrlD_Ddis        ------------------------------------------------------------
IrlE_Ddis        ------------------------------------------------------------
IrlF_Ddis        ------------------------------------------------------------
IrlF_C2d_Ddis    ------------------------------------------------------------
10577_Tthe       ---Y-----------LNHYIINI-NQKLIKQ---LNIFTK-----RENWALTST-DVNLM
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  LEEPESRG-----SSTTEVFIGR-TDYYISI---YPHRSKGYGTRAPVQNLSFS-VYGPN
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    -------------------VIE--------------------------SIG-----SLH-
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------YQLSR-YRLAVSVLTNRDLISPGVP-----FNEVYE-DI---
AqueK164_Aque    -------------------YCGHDYCYHNSI---TQLDTV-----SLQWRELEPTDATRP
AqueK165_Aque    ------------------YQVER-YRMVVTLLR-----RTALD-----SNKSFL-ELFMD
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    -----SMCPPNQYGSNKIIHIPS-IEYRVAV---LDSKTK-----QIKVNITYT-QYGTQ
AqueK169_Aque    -------------------LLER-YHFNKTL---YDRLG--LR-----LKL-FY-NTLEK
IRE-2_Smoe       -----------------------------------------------------------X
IRE-1_Smoe       -----------------------------------------------------------N


IRE2_Hsap        P----MDGSPGK------YM-SHLASCGMG-LLLTVDPG---SG----------------
IRE1_Hsap        L----PEDDVDY------KM-SHFVSNGDG-LVVTVDSE---SG----------------
ire-1_Dmel       S--APPELAKEY------EY-IHLTTTTNG-QIVTLDRK---HG----------------
IRE2_Mmus        L----LNGSPGK------YM-SHLTSCGMG-LLLTVDPG---SG----------------
IRE1_Mmus        L----PEDDVDY------KM-SHFVSNGDG-LVVTVDSE---SG----------------
ire-1_Cele       L----LPEVNTW------PF-KHYASSSHG-YILTFDRE---TG----------------
IRE1_Scer        ------------------------------------------------------------
IreA_Ddis        S--T-----KSF------YN-SEISLNFEG-LIEVASLS--QRMYKIYIKKPEKTVVGIS
IrlA_Ddis        --------------------------------------------AEMGGKYF--------
IrlB_Ddis        ---T-----KTS------TN-SNLSIDLVR-LLEFTTTNFSINVAKLLISKF--------
IrlB_C2d_Ddis    ---T-----KTS------TN-SNLSIDLVR-LLEFTTTNFSINVAKLLISKF--------
IrlC_Ddis        -----------K------QK-NPLEISPVT-LLEIAFLCFSDKIAIVLFSQ---------
IrlD_Ddis        ---N-----SNL------SE-NPLEINPLS-LLEICSANFSHKIASILFQF---------
IrlE_Ddis        ---Y-----SGF------DEKSKRKIR--I-FFSICCRQISPKILKCIVDY---------
IrlF_Ddis        ---A-----SDD------NN-NKISISILR-ILEITSIEFSLPVLTVIVENT--------
IrlF_C2d_Ddis    ---A-----SDD------NN-NKISISILR-ILEITSIEFSLPVLTVIVENT--------
10577_Tthe       I-----------------------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  N--EDNLLQANYRRTSDDAY-IQGFPNGDV-YSFKTKSE---GGRV------------QT
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    L----LKKCG--------------------------------------------------
AqueK164_Aque    VMRR-----GHG------GM-ISFEHDGVH-HLLMIGGG-------------------GG
AqueK165_Aque    L----TQELG--------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    S--------------------------------YTARQS---QG----------------
AqueK169_Aque    I----KKDHG--------------------------------------------------
IRE-2_Smoe       X----XX-XXXX------XX-X-XXXXXxSLTLLVSDGK---PS----------------
IRE-1_Smoe       L----AE-DIDY------PG-I-AAGNTTSLTVLVSDGK---PS----------------


IRE2_Hsap        TVLWTQD-LGVPVMGVYTWHQ-----------DGLRQLPHL-------------------
IRE1_Hsap        DVLWIQN-YASPVVAFYVWQR-----------EGLRKVMHI-------------------
ire-1_Dmel       KFLWQRD-LSSPVVAAFLLGP-----------DGLLSVPFT-------------------
IRE2_Mmus        IVLWTQD-LGVPVTGIYTWHQ-----------DGLHQLPHL-------------------
IRE1_Mmus        DVLWIQN-YASPVVAFYVWQG-----------EVLRKVVHI-------------------
ire-1_Cele       EMRWEQD-LKQPVVALYLLRD-----------DGLHKLPFE-------------------
IRE1_Scer        ---WQQNVLDVPLALQNTFSK-----------DGMCIAPFR-------------------
IreA_Ddis        HNYWEHI-LTSSPVSIYAYSS---------KKHILKKLDFHRKVSPYSNSLIPVASTDLM
IrlA_Ddis        ----NWT-LL-EPKLIKKEVN---------QKS---------------------------
IrlB_Ddis        ------------PTFITSIPS---------RNS---------------------------
IrlB_C2d_Ddis    ------------PTFITSIPS---------RNS---------------------------
IrlC_Ddis        ------------FNYHELLPK---------KSK---------------------------
IrlD_Ddis        ------------YDFKDSMPT---------RFS---------------------------
IrlE_Ddis        ------------V------KD---------DIG---------------------------
IrlF_Ddis        ------------PNFLNSIPT---------KTS---------------------------
IrlF_C2d_Ddis    ------------PNFLNSIPT---------KTS---------------------------
10577_Tthe       --YED----------------------------FLYKGLQK-------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  QPLWVQK-FHAPTVAVFDVLR---------GSTPLQPHPHA-------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ---------SYPVAIAF-------------------------------------------
AqueK164_Aque    S----KP-AVQLPHYK--YIKKSNGNWRTNEHS----------MYNLSSRK---------
AqueK165_Aque    ---------KYPLAVAL-------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    DKVWEKD-FGSPVVGIYSLEK---------S-QVLRSIPFT-------------------
AqueK169_Aque    KI---DD-CFIECLASW-------------------------------------------
IRE-2_Smoe       K-----------------------------------------------------------
IRE-1_Smoe       K-----------------------------------------------------------


IRE2_Hsap        ------------------------------------------------------------
IRE1_Hsap        ------------------------------------------------------------
ire-1_Dmel       ------------------------------------------------------------
IRE2_Mmus        ------------------------------------------------------------
IRE1_Mmus        ------------------------------------------------------------
ire-1_Cele       ------------------------------------------------------------
IRE1_Scer        ------------------------------------------------------------
IreA_Ddis        IPSNFDRTFMFDDYYGQLFIVSPPSNNNN---NNNNNNNNN--NNNNNNNNNNNNNNNNN
IrlA_Ddis        -------------LKGVIPPR--ELNSQQRNTQFFRVFNGVTGFNDI-------------
IrlB_Ddis        -------------LWGIESRS--SLNPIE---NHFRILNCSFDFNNH-------------
IrlB_C2d_Ddis    -------------LWGIESRS--SLNPIE---NHFRILNCSFDFNNH-------------
IrlC_Ddis        -------------MKHLIKST--STLINN---NNNNNNNNNNNNNNNNNNNNNNNNNNNN
IrlD_Ddis        -------------LRGVFKPT--TTT-TT---TTTTTT-TTTTTIDKDE-KDKENNNNNV
IrlE_Ddis        -------------FLDLQNRQ--DI----------------------------------Y
IrlF_Ddis        -------------MLGMKFKL--HNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNN
IrlF_C2d_Ddis    -------------MLGMKFKL--HNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNN
10577_Tthe       ------------------------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ------------------------------------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------------------------------------------------
AqueK164_Aque    -----------------------WSNP---------------------------------
AqueK165_Aque    ------------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ------------------------------------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ------------------------------------------------------------
IRE1_Hsap        ------------------------------------------------------------
ire-1_Dmel       ------------------------------------------------------------
IRE2_Mmus        ------------------------------------------------------------
IRE1_Mmus        ------------------------------------------------------------
ire-1_Cele       ------------------------------------------------------------
IRE1_Scer        ------------------------------------------------------------
IreA_Ddis        NNNNKNN-NNNNKNESDKSNLTPLTPYDPSKPNGANNNNNNNN--------------DL-
IrlA_Ddis        ------------------------------------------RFVYANP-----------
IrlB_Ddis        ----------------------------------------------------------Q-
IrlB_C2d_Ddis    ----------------------------------------------------------Q-
IrlC_Ddis        NSKNIG-LT----------------------------------------QYTVLEGYFLI
IrlD_Ddis        ISQQF---Q----------------------------------------YFRVLDVNCYF
IrlE_Ddis        ----IGDSA----------------------------------------PEKVLFLNCFF
IrlF_Ddis        NNNNINK-NNNDNGNGKAENIYRLSG-----DCKEKEKYDNNYSRETEIPFKVFDTKFL-
IrlF_C2d_Ddis    NNNNINK-NNNDNGNGKAENIYRLSG-----DCKEKEKYDNNYSRETEIPFKVFDTKFL-
10577_Tthe       --------NQLTENEDYIFMQD--------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ------------------------------------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------------------------------------------------
AqueK164_Aque    -----SI-IGQC------------------------------------------------
AqueK165_Aque    ------------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ------------------------------------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ------------------------------------------------------------
IRE1_Hsap        ------------------------------------------------------------
ire-1_Dmel       ------------------------------------------------------------
IRE2_Mmus        ------------------------------------------------------------
IRE1_Mmus        ------------------------------------------------------------
ire-1_Cele       ------------------------------------------------------------
IRE1_Scer        ------------------------------------------------------------
IreA_Ddis        --LDSNKLKNYDIYLYSSIVILITSI----------------------------------
IrlA_Ddis        --SLAQHAIKFIQKVTECGLFLNTDV----------------------------------
IrlB_Ddis        --IPIDKQKDYINLFTKNLIHFNTEI----------------------------------
IrlB_C2d_Ddis    --IPIDKQKDYINLFTKNLIHFNTEI----------------------------------
IrlC_Ddis        NIRTRSRIAPFIEVLTMNGIHLTNDIIHTRIKSMSSDSIFRIFTEQYQQQQQNPLNNNQK
IrlD_Ddis        NDVIKKRAPIFIDLMTQSNIYLNTEV----------------------------------
IrlE_Ddis        GNHKEQRVIDFFNLLTSKSIIICNTI----------------------------------
IrlF_Ddis        --ITTMECSDYIRFFTSSSIIFNTEV----------------------------------
IrlF_C2d_Ddis    --ITTMECSDYIRFFTSSSIIFNTEV----------------------------------
10577_Tthe       ------------------------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ------------------------------------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------------------------------------------------
AqueK164_Aque    ------------------------------------------------------------
AqueK165_Aque    ------------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ------------------------------------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ------------------------------------------------------------
IRE1_Hsap        ------------------------------------------------------------
ire-1_Dmel       ------------------------------------------------------------
IRE2_Mmus        ------------------------------------------------------------
IRE1_Mmus        ------------------------------------------------------------
ire-1_Cele       ------------------------------------------------------------
IRE1_Scer        ------------------------------------------------------------
IreA_Ddis        ------------------------------------------------------------
IrlA_Ddis        --------------------RNV--RDSIP-N----------------------------
IrlB_Ddis        --------------------NEI--EDLIL-K----------------------------
IrlB_C2d_Ddis    --------------------NEI--EDLIL-K----------------------------
IrlC_Ddis        QIQFNENFTRQQKIDFDNCPNEI--DTFI-LDKTQCNLITLSQEFSIKVRAFTFYLSFGE
IrlD_Ddis        --------------------GEG--SDEN-VD----------------------------
IrlE_Ddis        --------------------KEK--PEL--YD----------------------------
IrlF_Ddis        --------------------NQTCYDDLKLIQ----------------------------
IrlF_C2d_Ddis    --------------------NQTCYDDLKLIQ----------------------------
10577_Tthe       ------------------------------------------------------------
IRE1_Spur        ------------------------------------------------------------
CC1G_06931_Ccin  ------------------------------------------------------------
AqueK159_Aque    ------------------------------------------------------------
AqueK160_Aque    ------------------------------------------------------------
AqueK161_Aque    ------------------------------------------------------------
AqueK162_Aque    ------------------------------------------------------------
AqueK163_Aque    ------------------------------------------------------------
AqueK164_Aque    ------------------------------IP----------------------------
AqueK165_Aque    ------------------------------------------------------------
AqueK166_Aque    ------------------------------------------------------------
AqueK167_Aque    ------------------------------------------------------------
AqueK168_Aque    ------------------------------------------------------------
AqueK169_Aque    ------------------------------------------------------------
IRE-2_Smoe       ------------------------------------------------------------
IRE-1_Smoe       ------------------------------------------------------------


IRE2_Hsap        ------------------------------------------------------------
IRE1_Hsap        ------------------------------------------------------------
ire-1_Dmel       ------------------------------------------------------------
IRE2_Mmus        ------------------------------------------------------------
IRE1_Mmus        ------------------------------------------------------------
ire-1_Cele       ------------------------------------------------------------
IRE1_Scer        ------------------------------------------------------------
IreA_Ddis        ------------------------------------------------------------
IrlA_Ddis        -------------------------------------------SN