Protein (view, download) , Domain (view, download)
smi35A_Dmel      MLDRCEMPIQL---------------------------DN---EK---------------
Dyrk3_Dmel       MINQNLTHTGIA-------------Q----N-------NT--------------------
DYRK4_Mmus       MQLLRLPALTRT-------------E--TSM-------DT---NK----AR---------
DYRK3_Mmus       MGGAARDRGRKD-------------A-A--L-------PG---A-----GL---------
DYRK2_Mmus       MLTRKPSAAAPA-------------A----Y-------PT---GR----GG---------
mbk-2_Cele       MAALASFTRNSR-------------S-YGQQ-------PIDVTQQ----GQ---------
C36B7.2_Cele     MADIQRHFSNLV-------------I------------GA----S----P----------
C36B7.1_Cele     MSLLIKSVQIVK-------------L------------HA----F---------------
DYRK4_Hsap       MQLLPPPIRTGT-------------K--TQM-------DA---KK----PR---------
DYRK3_Hsap       MGGTARGPGRKD-------------A-G--P-------PG---A-----GL---------
DYRK2_Hsap       MLTRKPSAAAPA-------------A----Y-------PT---GR----GG---------
Dyrk2_Ddis       MTSLHKQIIESH-------------NND--I-------TK----------L---------
5306_Tthe        MYIFNTFIQFCSQTKEAEKVQSTRNS----F-------AI---DQKNKDSI---------
5356_Tthe        MQFYNPNSSSSA-------------S----K-------NS---NI----KV---------
5655_Tthe        MHNNSSANN----------------S----F-------NN---EQ----AL---------
DYRK2_Spur       MVDSMVDAIAR-------------------K-------PN---LQ----AS---------
DYRK4_Spur       MPACLHGVASMG-------------K------------------R----P----------
CC1G_13957_Ccin  MSASPDPPQQYK-------------A----------------------------------
AqueK112_Aque    MERGTGSTKERS-------------F--SYS-------KA----T----PL---------
AqueK113_Aque    MLAMYNSQSLTS-------------A------------NT--------------------
DYRK2_b_Smoe     MAQTDRSAYADV-------------A----------------------------------
DYRK2_a_Smoe     MAQTDRSAYADV-------------A----------------------------------
GK034_Glam       MFAPGNSARAQR-------------Q-V--I-------PG---DHF---GL---------
GK033_Glam       MDTITLIAGFLR-------------Q-HGENELAENVENC---ES----LR---------
GK032_Glam       MIQPEALHQLIY----------------DHV-------YV---KY----GHQLAFTIRAL
                 *

smi35A_Dmel      -----------------------------------------LRR----------------
Dyrk3_Dmel       -E------------------------K--------------ANR----------------
DYRK4_Mmus       ------------------------------------------KR----------------
DYRK3_Mmus       -P------------------------P--------------QQR----------------
DYRK2_Mmus       -D------------------------T--------------AVR----------------
mbk-2_Cele       RD-RSVMSLD----------------A--------------QGR----------------
C36B7.2_Cele     ------------------------------------------LT----------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------KC----------------
DYRK3_Hsap       -P------------------------P--------------QQR----------------
DYRK2_Hsap       -D------------------------S--------------AVR----------------
Dyrk2_Ddis       -K--SSMSTR----------------AA-------------ARRSVCLSSMSYTLG----
5306_Tthe        -L-Q----SN--------------------------------------------------
5356_Tthe        -Q-QN-------------------------------------------------------
5655_Tthe        -L-ST---VD--------------------------------------------------
DYRK2_Spur       -----------------------------------------RTR----------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ---------R----------------PA-------------ALAIHDDEGTQPSDGDDQI
AqueK112_Aque    -L------------------------PSLTSPRGSENGGSHFDR----------------
AqueK113_Aque    -K------------------------T--------------FNR----------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       -V--I-TSG-----------------------------------------RSVSKG----
GK033_Glam       -RETRI-TTDLEFLLNISRGCVTVETL--------------ANR----------------
GK032_Glam       LN------------------------A--------------KER----------------


smi35A_Dmel      ---------D------------------------------------------V-------
Dyrk3_Dmel       ---------H------------------------------------------Q-------
DYRK4_Mmus       ---------S------------------------------------------L-------
DYRK3_Mmus       ---------R------------------------------------------L-------
DYRK2_Mmus       ---------Q------------------------------------------L-------
mbk-2_Cele       ---------S-------VSHECPTSTTLVR---------------------QL-------
C36B7.2_Cele     ---------K------------------------------------------L-------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ---------D------------------------------------------L-------
DYRK3_Hsap       ---------R------------------------------------------L-------
DYRK2_Hsap       ---------Q------------------------------------------L-------
Dyrk2_Ddis       --------AD------------------------------------------D-------
5306_Tthe        -----------------IS---------QPESTKNHFGYQNQLAHQQIQQQQL----QQQ
5356_Tthe        -----------------L------------------------------------------
5655_Tthe        -----------------LA---------SQ---------------------DI----SA-
DYRK2_Spur       ---------S------------------------------------------L-------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  DNCQHQHLL---------------------------------------------------
AqueK112_Aque    ---------S------------------------------------------FMRKGI--
AqueK113_Aque    ---------T------------------------------------------L-------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       --------RD------------------------------------------Q-------
GK033_Glam       ---------SAMIKEHNM------------------------------------------
GK032_Glam       ---------C------------------------------------------M-------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------Y----R------------------------------------
DYRK4_Mmus       ------------------T----T--------------------------FP-ILKARKK
DYRK3_Mmus       ------------------G-----------------------------------------
DYRK2_Mmus       ------------------Q----A------------------------------------
mbk-2_Cele       ------------------Y----L------------------------------------
C36B7.2_Cele     ------------------W----A------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------T----P--------------------------FL-VLKARKK
DYRK3_Hsap       ------------------G-----------------------------------------
DYRK2_Hsap       ------------------Q----A------------------------------------
Dyrk2_Ddis       ------------------V----TPITSNTTPSNNNNNNNTTTTITTTTTTP-TISPL-K
5306_Tthe        QQSLQQMQQQQQQMTLQQS-----------------------------------------
5356_Tthe        ------------------N-----------------------------------------
5655_Tthe        ------------------Q-----------------------------------------
DYRK2_Spur       ------------------T----Q------------------------------------
DYRK4_Spur       ---------------------------------------------------------REK
CC1G_13957_Ccin  -----------------------QPLTINVSHQDNDDSNHSRSTSVTSSLDP-YYFGL-A
AqueK112_Aque    ------------------S----S--------------------------LSLSERESKK
AqueK113_Aque    ------------------V----Y------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------A----S------------------------------------
GK033_Glam       ------------------ASTIDK-----------------------FVIHP-VFFGR-R
GK032_Glam       ------------------SKLVAS------------------------------------


smi35A_Dmel      -R------------------------------------------------LS--------
Dyrk3_Dmel       -----------------------------------------------------D------
DYRK4_Mmus       QS------------------------------------------------FT-S------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       -----------------------------------------------------S------
mbk-2_Cele       --------------------------------------------------PQ-I------
C36B7.2_Cele     -----------------------------------------------------D------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       QK------------------------------------------------FT-S------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       -----------------------------------------------------S------
Dyrk2_Ddis       QS------------------------------------------------TT-G------
5306_Tthe        -----------------------------------------------------Q------
5356_Tthe        -----------------------------------------------------N------
5655_Tthe        -----------------------------------------------------N------
DYRK2_Spur       --------------------------------------------------G--D------
DYRK4_Spur       NH------------------------------------------------IS-N------
CC1G_13957_Ccin  ES------------------------------------------------PE-H------
AqueK112_Aque    SH------------------------------------------------FT-H------
AqueK113_Aque    --------------------------------------------------P--S------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       -----------------------------------------------------D------
GK033_Glam       RALENEFLLEMFRDIDTKVDYLGLVPVTSKRYRMSVCHKQPYQHLYLKRIFPADQKLKGL
GK032_Glam       -----------------------------------------------------ES-----


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ---S--------------------------------------------------------
DYRK4_Mmus       -VKV--------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ---P--------------------------------------------------------
mbk-2_Cele       ---P--------------------------------------------------------
C36B7.2_Cele     ---H--------------------------------------------------------
C36B7.1_Cele     ---F--------------------------------------------------------
DYRK4_Hsap       -AKV--------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ---P--------------------------------------------------------
Dyrk2_Ddis       ---S--------------------------------------------------------
5306_Tthe        ---N--------------------------------------------------------
5356_Tthe        ---S--------------------------------------------------------
5655_Tthe        ---S--------------------------------------------------------
DYRK2_Spur       ---T--------------------------------------------------------
DYRK4_Spur       ---G--------------------------------------------------------
CC1G_13957_Ccin  ---NPNQLSITPDHPPPNEPVTPARNPASIDRRGLVGVGELATPRWTRDPSPDPHLDDDV
AqueK112_Aque    -SLG--------------------------------------------------------
AqueK113_Aque    ---S--------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ---A--------------------------------------------------------
GK033_Glam       APD---------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ----------------------------------------------------G----L--
DYRK4_Mmus       ----------------------------------------------------ESKPLGH-
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ----------------------------------------------------G----I--
mbk-2_Cele       ----------------------------------------------------Q----SA-
C36B7.2_Cele     ----------------------------------------------------G----T--
C36B7.1_Cele     ----------------------------------------------------Q----L--
DYRK4_Hsap       ----------------------------------------------------GSKLSVQ-
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ----------------------------------------------------G----L--
Dyrk2_Ddis       ----------------------------------------------------I-------
5306_Tthe        ----------------------------------------------------Q----LNQ
5356_Tthe        ----------------------------------------------------Q----L--
5655_Tthe        ----------------------------------------------------R----F--
DYRK2_Spur       ----------------------------------------------------A----T--
DYRK4_Spur       ----------------------------------------------------A----VK-
CC1G_13957_Ccin  PPLPDRPEDDAPDSPWTIEAIDGELSDSDEVSAPAPFPASNNVLIFLKVKIPE-------
AqueK112_Aque    ----------------------------------------------------G----VH-
AqueK113_Aque    ----------------------------------------------------E----V--
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ----------------------------------------------------P-------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       -----------------SFAAAPTS-----------------------------FS----
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ---------------------IPKS-----------------------------IL----
5306_Tthe        QHQQQLIMMIQQQQQQQHGQQLPNQ-----------------------------------
5356_Tthe        -----------------NNALSPKK-----------------------------NISLDL
5655_Tthe        -----------------SSGPSPKS-----------------------------KNFVPI
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ---------------------LPPP-----------------------------ARPL--
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ---------------------IPQT-----------------------------V-----
DYRK2_a_Smoe     ---------------------IPQT-----------------------------V-----
GK034_Glam       ---------------------PPPP-----------------------------AR----
GK033_Glam       ---------------------SPPAMGYARLSNPYMDYYKGETGFARQIILGHKI-----
GK032_Glam       ---------------------EPSAL----------------------------E-----


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       GASSSSSNHH-----------------------HP--V----------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       -------------------------------------------------VT---------
5306_Tthe        ----------------TSSKKSNQQ-----QQMQQNQI----------------------
5356_Tthe        GS-RKI----------------SPLDNSLRKR---IEY----------------------
5655_Tthe        TA-KNASNQQAIVMNAIKSKIQNIFQQQQQQRQQPQQL----------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  -----------------------------RT-----RPSIADESGGEEILYPRNVIQSVP
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       -------------------KSGSKEEPIV-------------------------------
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  DHPPPTVVPPLDDHIPKQPRTPASADPPISSPPSAFSSSTRKARKRTSDEFELDQTGALV
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       --------------------SAAVAR----------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       -Y------------HSQ-------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ---------------------------------------------------------SSS
5306_Tthe        -QQ---------SQYSN-------------------------------------------
5356_Tthe        -QR---------DSKQS-------------------------------------------
5655_Tthe        -QQ---------S---T-------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  SKRGSLKEKSRDDARASIRKHRSLNVSTSSSTSPRDSKTRERKRESIGLGLAISSSVVSP
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       KSS-------SNSSSINNNFNNLYSASTFSSSTKKV------------------------
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  RLAERHSRQAS------------------SS---SVSSPSSEPAPARRVHTTDFSHLPPS
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       -----------HERPSINPG----------------------------------------
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  PSSSSIQQFLRQTIPKEPPSLHSPPNVAHSLLRGTQEGWSGLDDEATAEALRKLDGLTGK
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ---------------------------------------------------FRKPREALL
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  TARSRASMTSLGRGSSASRPGTPAKSSQQWEGISGSESVRSKRISTFIREGGKEPRSTPN
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ---------------------------------------------------ARRPYKIGP
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       S--------------GNSDSGIIKKPSS---SSTSSSSS---------------------
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  PSEGALDSDYVAVSVSGAISSDEPHIIQDKTPKKQSRLSFTPKRGSTSSTTYGSTPTTSS
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       T--------------GTSGTNLIFAPAS---SI---------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ------------------------------------------------------------
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  RDSAGTATTNATSVSATSGGRVSSTKARRNSAGSDVSSVHSNDLTLLKDRAAHLAATGEL
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ------------------------------------------------------------
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  IDDAHVPPVPPLPKDLSSYRSPPTTSSTQTFRSIPSVEDPDIRISQDSDIERAFSSDVSA
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       -----------------Q------------------------------------------
DYRK4_Mmus       ----------L------QKPSS--------------KN----------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       -----------------G------------------------------------------
mbk-2_Cele       ----------N------SLPPNLLGSSQNSASSNSLV-----------------------
C36B7.2_Cele     -----------------K------------------------------------------
C36B7.1_Cele     -----------------R------------------------------------------
DYRK4_Hsap       ----------I------QKPPS--------------NI----------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       -----------------G------------------------------------------
Dyrk2_Ddis       ---SSSTTSNI------KAPIQ--------------I-----------------------
5306_Tthe        ----------V------LNLLM-----------------------------QQQPTQPPQ
5356_Tthe        ----------I------KQPKL--------------TLNTSSHNNTCNLSNNQSFAQST-
5655_Tthe        ----------V------LQPSI--------------D--------------IQQYKQPNQ
DYRK2_Spur       -----------------T------------------------------------------
DYRK4_Spur       ----------A-------SQPI--------------QI----------------------
CC1G_13957_Ccin  GKGPRVGSS-A------TRQSQ--------------A-----------------------
AqueK112_Aque    ----------Y------NAPPL--------------SI----------------------
AqueK113_Aque    -----------------KDPIV--------------D-----------------------
DYRK2_b_Smoe     ----------V------QTPSK--------------D--------------WET------
DYRK2_a_Smoe     ----------V------QTPSK--------------D--------------WET------
GK034_Glam       ------VHKAV------SVPKQ--------------Y-----------------------
GK033_Glam       ----------E------KIQSR--------------D--------------FEPHN----
GK032_Glam       ----------LLVTYGFT------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       --------------------------------Y-----------LT------R------C
DYRK4_Mmus       --------------------------------KKL--------RVN------R-------
DYRK3_Mmus       --------------------------------D-----G--VY-DT------F------M
DYRK2_Mmus       --------------------------------A-----G--AP-RS------G------V
mbk-2_Cele       ------------------QGHRNPAL-----GS-----G--NT-LT------R------S
C36B7.2_Cele     --------------------------------G-----G--V------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       --------------------------------KNS--------RMT------Q-------
DYRK3_Hsap       --------------------------------D-----G--VY-DT------F------M
DYRK2_Hsap       --------------------------------A-----G--AT-RS------G------V
Dyrk2_Ddis       ----------------------SH----------SSNSG--SS-SSGGNNNNS-------
5306_Tthe        QHQQIYQNLNNSQQYTTMQQ----SSG--QNY----------------------------
5356_Tthe        KHYQGNSSIHISGEKTLTQPNVNPSG-----G----------------------------
5655_Tthe        KKRDLVLTLKKSTEN----------LADSFI-----------------------------
DYRK2_Spur       --------------------------------A-----L--YP-----------------
DYRK4_Spur       --------------------------------NGV---LG-RR--T------NG-----L
CC1G_13957_Ccin  ----------------------NP----------NTSEA---------------------
AqueK112_Aque    --------------------------------NSV----G-RSKVT------MG-----M
AqueK113_Aque    ---------------------FDP--------E-----G--IP-KT------T------T
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       --------------------------------E-----GDSVHIKT------FTQCNDAL


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       MIDETK------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       -----YHQPSSTNSST------------NNLY----------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       MIDETK------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       --------------------------------------------------------DDNS
5306_Tthe        ---------------SNQ-SFTTNRQNSNANYL-----YHQLNPPQSTKAADSNRRQNNP
5356_Tthe        ---------------INT-NTASNVNNSNSLII-----NHILDSTKSQGGTININANNIS
5655_Tthe        -----------------NSCNITQNGSTKSSYVRNNKITQENIAPQQAQNNEP------S
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ------------------------------------------------------------
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       IP-EKK------------------------------------------------------
GK032_Glam       LVTGSS------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       -----------------------------------------------------------F
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       -----------------------------------------------------------G
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       -----------GPLG-------------------------------TISRDLKQSIRDIS
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       -----------------------------------------------------------C
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       --GSSTIKH---------------------------------------------------
5306_Tthe        FSGTYSTKNTSAPQQLLKDILSKINKEQVQQQLPYQQNQQVLRSSHMM----NNS---QN
5356_Tthe        FHNQYNITNL----------------------------------VSQM----NRK---RQ
5655_Tthe        YDEEYI--------------------------SDAK-------FISQI----NRT---KK
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ------------------------------------------------------------
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    -----------------------------------------------------------M
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       -----------------------------------------------------------G
GK032_Glam       -----------------------------------------------------------I


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------EPLA--
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------PPYS--
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------PPVINS
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------PPCS--
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ------------------------------------------------------------
5306_Tthe        NSNSNVVILNN---NTQNANNQNIYSSNYVNTNPDLSNIYNPNNLAA-M-----NPQPSS
5356_Tthe        PIGGNVIVNNSVGQNTMISNNINQLSANVQN----LNNILNYQNSGASTATNSNAPRSIQ
5655_Tthe        ------------------------------------------------------PPQPKK
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ------------------------------------------------------------
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------TPAQE-
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       L-----------------------------------------------------------
GK032_Glam       ------------------------------------------------------EPTV--


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       S--------ANPHL----------------------V-----------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ------------------------------------------------------------
5306_Tthe        TKSNRIHSHYFPATTKNKSNRNPSLDKLNDSSFLRLKNVQSPKQRTIRTIMPGSNRDNSV
5356_Tthe        -----FHQYGAPNST---------------------------------------------
5655_Tthe        G------------------ATVPTNQSI--------NNLQSAQQ----ELQLNYN-NNNI
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ------------------------------------------------------------
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ------------------------------------------------------------
5306_Tthe        GNNSSINRNGYFQREYSESGVDASNQYILPASLLQQK----TKRSGNSITGGVNNVIANN
5356_Tthe        ------------------------------------------------------------
5655_Tthe        KNGKKI----------------------------SRYGEEYSKRQSFQMNGGKQMYCHNE
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ------------------------------------------------------------
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ----------------------------------------------------NYVQTSSF
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ------------------------------------------------------------
5306_Tthe        NNSYNNGSYSKIQPHLPQNQTRQNGTPYVKKDLTIKTGNSIETLKDILSPTNN-------
5356_Tthe        ----------------------------------------------------N-------
5655_Tthe        QLQIDKCETINIPSHIYSK-------------------------------STN-------
DYRK2_Spur       ------------------------------------------------------------
DYRK4_Spur       ------------------------------------------------------------
CC1G_13957_Ccin  ------------------------------------------------------------
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ------------------------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------------------------------------------
GK033_Glam       ------------------------------------------------------------
GK032_Glam       ------------------------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ----------------------------M--------------LN---------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ----------------------------D--------------TF---------------
DYRK2_Mmus       ---------------G------------T--------------GP---------------
mbk-2_Cele       DNGSYEFPSGQAQQQR------------R--------------LG---------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ----------------------------N--------------VL---------------
DYRK2_Hsap       ---------------G------------T--------------GP---------------
Dyrk2_Ddis       ----------------------------TAASLSKMKLSPSHTISDSPRSSTMKSRSVSI
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       ---------------H------------H--------------GH---------------
DYRK4_Spur       ---------------Q------------S---------------E---------------
CC1G_13957_Ccin  ------------------------------------------------------------
AqueK112_Aque    ---------------S------------S---------------T---------------
AqueK113_Aque    ---------------T------------K--------------MF---------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ----------------------------------------KHYA----------------
GK033_Glam       ---------------GLATRGTIAAAEAA--------------DP---------------
GK032_Glam       ----------------------------D--------------VL---------------


smi35A_Dmel      -------------------------GS----------RLD-----------L--PQL-C-
Dyrk3_Dmel       -------------------------DS----------KED-----------F--PTQ-P-
DYRK4_Mmus       ---------------------------------------------------C--PQK-I-
DYRK3_Mmus       -------------------------SN----------PSE-----------A--PVS-R-
DYRK2_Mmus       -------------------------PS----------PIA-----------L--PPL-R-
mbk-2_Cele       -------------------------GS----------QQH-----------L--APL-Q-
C36B7.2_Cele     ---------------------------------------ATNGKQHHEWQRV--MTM-R-
C36B7.1_Cele     --------------------------------------------------MI--VPA-R-
DYRK4_Hsap       ---------------------------------------------------V--FHK-N-
DYRK3_Hsap       -------------------------CN----------PSE-----------P--PPP-R-
DYRK2_Hsap       -------------------------PS----------PIA-----------L--PPL-R-
Dyrk2_Ddis       SNGSLFSPTNTSVNNSNNNTSSNIKTPTKS-SISENLDQN-----------TP-PPPSSS
5306_Tthe        ------------------------------------------------------------
5356_Tthe        ------------------------------------------------------------
5655_Tthe        ------------------------------------------------------------
DYRK2_Spur       -------------------------GS----------HVE-----------L--PPI-K-
DYRK4_Spur       -------------------------KL----------SNS-----------L--PPA-S-
CC1G_13957_Ccin  --------------------VPIVKTPSKKWSFSSALNLK-----------LASSPSSSS
AqueK112_Aque    -------------------------GV----------SMA-----------T--RPS---
AqueK113_Aque    -------------------------SG----------AVT-----------L--PPL-L-
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       ------------------------RDP----------DDK-----------I--EPF-SA
GK033_Glam       -------------------------YP----------KVP-----------V--PTM-S-
GK032_Glam       -------------------------QT----------HQD-----------P--PLP-Q-


smi35A_Dmel      ---------NGSR-----------------------------------------------
Dyrk3_Dmel       ---------SN-------------------------------------------------
DYRK4_Mmus       ---------PSNT-----------------------------------------------
DYRK3_Mmus       ---------RLNI-----------------------------------------------
DYRK2_Mmus       ---------ASNA-----------------------------------------------
mbk-2_Cele       ---------QTAS-----------------------------------------------
C36B7.2_Cele     ----------LDR-----------------------------------------------
C36B7.1_Cele     ----------V-S-----------------------------------------------
DYRK4_Hsap       ---------TSVT-----------------------------------------------
DYRK3_Hsap       ---------RLNM-----------------------------------------------
DYRK2_Hsap       ---------ASNA-----------------------------------------------
Dyrk2_Ddis       STTKTPTATTTTT-----------------------------------------------
5306_Tthe        ---------NANP-----------------------------------------------
5356_Tthe        ---------KVNS-----------------------------------------------
5655_Tthe        ---------HSA------------------------------------------------
DYRK2_Spur       ---------SH-------------------------------------------------
DYRK4_Spur       ---------SGQT-----------------------------------------------
CC1G_13957_Ccin  TKSSFPL-----------------------------------------------------
AqueK112_Aque    ------------------------------------------------------------
AqueK113_Aque    ---------KSSS-----------------------------------------------
DYRK2_b_Smoe     ------------------------------------------------------------
DYRK2_a_Smoe     ------------------------------------------------------------
GK034_Glam       AASKDTTSKGSSV-----------------------------------------------
GK033_Glam       ---------ASEKQVLSRKITPRALKEFIELKRRIIRLLTQRVAPEADVTVKLLDVLGSF
GK032_Glam       ---------EINI-----------------------------------------------


smi35A_Dmel      ------------------------------------------------------------
Dyrk3_Dmel       ------------------------------------------------------------
DYRK4_Mmus       ------------------------------------------------------------
DYRK3_Mmus       ------------------------------------------------------------
DYRK2_Mmus       ------------------------------------------------------------
mbk-2_Cele       ------------------------------------------------------------
C36B7.2_Cele     ------------------------------------------------------------
C36B7.1_Cele     ------------------------------------------------------------
DYRK4_Hsap       ------------------------------------------------------------
DYRK3_Hsap       ------------------------------------------------------------
DYRK2_Hsap       ------------------------------------------------------------
Dyrk2_Ddis       ------------------------------------------------------------
5306_Tthe        ------------------------------------------